Recombinant Human GATA4
| Cat.No. : | GATA4-28985TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 343-442 of Human GATA4 with a proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | This gene encodes a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function. Mutations in this gene have been associated with cardiac septal defects. |
| Molecular Weight : | 36.630kDa |
| Biological activity : | useful for Antibody Production and Protein Array |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | ASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA |
| Sequence Similarities : | Contains 2 GATA-type zinc fingers. |
| Gene Name | GATA4 GATA binding protein 4 [ Homo sapiens ] |
| Official Symbol | GATA4 |
| Synonyms | GATA4; GATA binding protein 4; transcription factor GATA-4; |
| Gene ID | 2626 |
| mRNA Refseq | NM_002052 |
| Protein Refseq | NP_002043 |
| MIM | 600576 |
| Uniprot ID | P43694 |
| Chromosome Location | 8p23.1-p22 |
| Pathway | Adipogenesis, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Heart Development, organism-specific biosystem; Hemostasis, organism-specific biosystem; Incretin Synthesis, Secretion, and Inactivation, organism-specific biosystem; |
| Function | DNA binding; activating transcription factor binding; metal ion binding; protein binding; sequence-specific DNA binding; |
| ◆ Recombinant Proteins | ||
| Gata4-536R | Recombinant Rat Gata4 Protein, His-tagged | +Inquiry |
| GATA4-8835Z | Recombinant Zebrafish GATA4 | +Inquiry |
| GATA4-5529C | Recombinant Chicken GATA4 | +Inquiry |
| GATA4-2138R | Recombinant Rat GATA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GATA4-535H | Recombinant Human GATA4 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GATA4-6010HCL | Recombinant Human GATA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GATA4 Products
Required fields are marked with *
My Review for All GATA4 Products
Required fields are marked with *
