Recombinant Human GATA4

Cat.No. : GATA4-28985TH
Product Overview : Recombinant fragment corresponding to amino acids 343-442 of Human GATA4 with a proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function. Mutations in this gene have been associated with cardiac septal defects.
Molecular Weight : 36.630kDa
Biological activity : useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA
Sequence Similarities : Contains 2 GATA-type zinc fingers.
Gene Name GATA4 GATA binding protein 4 [ Homo sapiens ]
Official Symbol GATA4
Synonyms GATA4; GATA binding protein 4; transcription factor GATA-4;
Gene ID 2626
mRNA Refseq NM_002052
Protein Refseq NP_002043
MIM 600576
Uniprot ID P43694
Chromosome Location 8p23.1-p22
Pathway Adipogenesis, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Heart Development, organism-specific biosystem; Hemostasis, organism-specific biosystem; Incretin Synthesis, Secretion, and Inactivation, organism-specific biosystem;
Function DNA binding; activating transcription factor binding; metal ion binding; protein binding; sequence-specific DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GATA4 Products

Required fields are marked with *

My Review for All GATA4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon