Recombinant Human GATAD1 Protein, GST-tagged
Cat.No. : | GATAD1-4754H |
Product Overview : | Human GATAD1 full-length ORF ( NP_066990.3, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene contains a zinc finger at the N-terminus, and is thought to bind to a histone modification site that regulates gene expression. Mutations in this gene have been associated with autosomal recessive dilated cardiomyopathy. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jun 2012] |
Molecular Mass : | 55.1 kDa |
AA Sequence : | MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGRGGAGSGGAGSGAAGGTGGSGGGGFGAATFASTSATPPQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKNPIKAPESVSTIITAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLSSPRDQFDPASYIIGPEEDLPRKMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKESVANHL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GATAD1 GATA zinc finger domain containing 1 [ Homo sapiens ] |
Official Symbol | GATAD1 |
Synonyms | GATAD1; GATA zinc finger domain containing 1; GATA zinc finger domain-containing protein 1; FLJ22489; ocular development associated gene; ODAG; RG083M05.2; ocular development associated; ocular development-associated gene protein; FLJ40695; |
Gene ID | 57798 |
mRNA Refseq | NM_021167 |
Protein Refseq | NP_066990 |
MIM | 614518 |
UniProt ID | Q8WUU5 |
◆ Recombinant Proteins | ||
GATAD1-3486M | Recombinant Mouse GATAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GATAD1-4891C | Recombinant Chicken GATAD1 | +Inquiry |
GATAD1-3786Z | Recombinant Zebrafish GATAD1 | +Inquiry |
GATAD1-1816R | Recombinant Rhesus monkey GATAD1 Protein, His-tagged | +Inquiry |
GATAD1-1637R | Recombinant Rhesus Macaque GATAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GATAD1-6008HCL | Recombinant Human GATAD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GATAD1 Products
Required fields are marked with *
My Review for All GATAD1 Products
Required fields are marked with *
0
Inquiry Basket