Recombinant Human GATC protein, GST-tagged
Cat.No. : | GATC-2942H |
Product Overview : | Recombinant Human GATC protein(O43716)(1-136aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-136aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.1 kDa |
AA Sequence : | MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
GATC-1080S | Recombinant Streptomyces coelicolor A3(2) GATC protein, His-tagged | +Inquiry |
GATC-2999S | Recombinant Staphylococcus epidermidis ATCC 12228 GATC protein, His-tagged | +Inquiry |
GATC-1265B | Recombinant Bacillus subtilis GATC protein, His-tagged | +Inquiry |
GATC-6231M | Recombinant Mouse GATC Protein | +Inquiry |
GATC-2140R | Recombinant Rat GATC Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GATC-6006HCL | Recombinant Human GATC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GATC Products
Required fields are marked with *
My Review for All GATC Products
Required fields are marked with *
0
Inquiry Basket