Recombinant Human GBE1 Protein, GST-tagged
Cat.No. : | GBE1-4771H |
Product Overview : | Human GBE1 full-length ORF ( AAH12098.1, 1 a.a. - 702 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a glycogen branching enzyme that catalyzes the transfer of alpha-1,4-linked glucosyl units from the outer end of a glycogen chain to an alpha-1,6 position on the same or a neighboring glycogen chain. Branching of the chains is essential to increase the solubility of the glycogen molecule and, consequently, in reducing the osmotic pressure within cells. Highest level of this enzyme are found in liver and muscle. Mutations in this gene are associated with glycogen storage disease IV (also known as Andersens disease). [provided by RefSeq |
Molecular Mass : | 106.8 kDa |
AA Sequence : | MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGSPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEVLRFLLSNIRWWLEEYRFDGFRFDGVTSMLYHHHGVGQGFSGDYSEYFGLQVDEDALTYLMLANHLVHTLCPDSITIAEDVSGMPALCSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESHDQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAPQAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDLPN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GBE1 glucan (1,4-alpha-), branching enzyme 1 [ Homo sapiens ] |
Official Symbol | GBE1 |
Synonyms | GBE1; glucan (1,4-alpha-), branching enzyme 1; 1,4-alpha-glucan-branching enzyme; Andersen disease; glycogen branching enzyme; glycogen storage disease type IV; brancher enzyme; glycogen-branching enzyme; amylo-(1,4 to 1,6) transglucosidase; amylo-(1,4 to 1,6) transglycosylase; GBE; |
Gene ID | 2632 |
mRNA Refseq | NM_000158 |
Protein Refseq | NP_000149 |
MIM | 607839 |
UniProt ID | Q04446 |
◆ Recombinant Proteins | ||
GBE1-2146HFL | Recombinant Full Length Human GBE1 Protein, C-Flag-tagged | +Inquiry |
GBE1-1818R | Recombinant Rhesus monkey GBE1 Protein, His-tagged | +Inquiry |
GBE1-187HF | Recombinant Full Length Human GBE1 Protein | +Inquiry |
Gbe1-3167M | Recombinant Mouse Gbe1 Protein, Myc/DDK-tagged | +Inquiry |
GBE1-1639R | Recombinant Rhesus Macaque GBE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GBE1-5999HCL | Recombinant Human GBE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GBE1 Products
Required fields are marked with *
My Review for All GBE1 Products
Required fields are marked with *