Recombinant Human GBP3 Protein, GST-tagged

Cat.No. : GBP3-4778H
Product Overview : Human GBP3 partial ORF ( NP_060754, 132 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the guanylate-binding protein (GBP) family. GBPs specifically bind guanine nucleotides (GMP, GDP, and GTP) and contain two of the three consensus motifs found in typical GTP-binding proteins. The encoded protein interacts with a member of the germinal center kinase family. [provided by RefSeq
Molecular Mass : 32.12 kDa
AA Sequence : GTINQQAMDQLYYVTELTHRIRSKSSPDENENEDSADFVSFFPDFVWTLRDFSLDLEA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GBP3 guanylate binding protein 3 [ Homo sapiens ]
Official Symbol GBP3
Synonyms GBP3; guanylate binding protein 3; guanylate-binding protein 3; FLJ10961; GBP-3; GTP-binding protein 3; guanylate-binding protein 3 delta C; guanine nucleotide-binding protein 3; DKFZp686E0974; DKFZp686L15228;
Gene ID 2635
mRNA Refseq NM_018284
Protein Refseq NP_060754
MIM 600413
UniProt ID Q9H0R5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GBP3 Products

Required fields are marked with *

My Review for All GBP3 Products

Required fields are marked with *

0
cart-icon