Recombinant Human GBP3 Protein, GST-tagged

• Cat.No.: GBP3-4778H
• Product Overview: Human GBP3 partial ORF ( NP_060754, 132 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the guanylate-binding protein (GBP) family. GBPs specifically bind guanine nucleotides (GMP, GDP, and GTP) and contain two of the three consensus motifs found in typical GTP-binding proteins. The encoded protein interacts with a member of the germinal center kinase family. [provided by RefSeq
• Molecular Mass: 32.12 kDa
• AA Sequence: GTINQQAMDQLYYVTELTHRIRSKSSPDENENEDSADFVSFFPDFVWTLRDFSLDLEA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GBP3 guanylate binding protein 3 [ Homo sapiens ]
• Official Symbol: GBP3
• Synonyms: GBP3; guanylate binding protein 3; guanylate-binding protein 3; FLJ10961; GBP-3; GTP-binding protein 3; guanylate-binding protein 3 delta C; guanine nucleotide-binding protein 3; DKFZp686E0974; DKFZp686L15228
• Gene ID: 2635
• mRNA Refseq: NM_018284
• Protein Refseq: NP_060754
• MIM: 600413
• UniProt ID: Q9H0R5