Recombinant Human GBX2 Protein, GST-tagged

Cat.No. : GBX2-4784H
Product Overview : Human GBX2 partial ORF (NP_001476.2, 141 a.a. - 230 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 141-230 a.a.
Description : GBX2 (Gastrulation Brain Homeobox 2) is a Protein Coding gene. Diseases associated with GBX2 include Velocardiofacial Syndrome. Among its related pathways are Embryonic and Induced Pluripotent Stem Cell Differentiation Pathways and Lineage-specific Markers and Neural Crest Differentiation. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and sequence-specific DNA binding. An important paralog of this gene is GBX1.
Molecular Mass : 35.53 kDa
AA Sequence : AEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GBX2 gastrulation brain homeobox 2 [ Homo sapiens ]
Official Symbol GBX2
Synonyms GBX2; gastrulation brain homeobox 2; gastrulation brain homeo box 2; homeobox protein GBX-2; gastrulation and brain-specific homeobox protein 2;
Gene ID 2637
mRNA Refseq NM_001485
Protein Refseq NP_001476
MIM 601135
UniProt ID P52951

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GBX2 Products

Required fields are marked with *

My Review for All GBX2 Products

Required fields are marked with *

0
cart-icon