Recombinant Human GBX2 Protein, GST-tagged
Cat.No. : | GBX2-4784H |
Product Overview : | Human GBX2 partial ORF (NP_001476.2, 141 a.a. - 230 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 141-230 a.a. |
Description : | GBX2 (Gastrulation Brain Homeobox 2) is a Protein Coding gene. Diseases associated with GBX2 include Velocardiofacial Syndrome. Among its related pathways are Embryonic and Induced Pluripotent Stem Cell Differentiation Pathways and Lineage-specific Markers and Neural Crest Differentiation. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and sequence-specific DNA binding. An important paralog of this gene is GBX1. |
Molecular Mass : | 35.53 kDa |
AA Sequence : | AEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GBX2 gastrulation brain homeobox 2 [ Homo sapiens ] |
Official Symbol | GBX2 |
Synonyms | GBX2; gastrulation brain homeobox 2; gastrulation brain homeo box 2; homeobox protein GBX-2; gastrulation and brain-specific homeobox protein 2; |
Gene ID | 2637 |
mRNA Refseq | NM_001485 |
Protein Refseq | NP_001476 |
MIM | 601135 |
UniProt ID | P52951 |
◆ Recombinant Proteins | ||
GBX2-1323H | Recombinant Human GBX2 Protein, His-tagged | +Inquiry |
GBX2-6253M | Recombinant Mouse GBX2 Protein | +Inquiry |
GBX2-6625C | Recombinant Chicken GBX2 | +Inquiry |
GBX2-3499M | Recombinant Mouse GBX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GBX2-9430Z | Recombinant Zebrafish GBX2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GBX2-5996HCL | Recombinant Human GBX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GBX2 Products
Required fields are marked with *
My Review for All GBX2 Products
Required fields are marked with *
0
Inquiry Basket