Recombinant Human GC Protein, His-tagged

Cat.No. : GC-200H
Product Overview : Recombinant Human GC, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : The protein encoded by this gene belongs to the albumin gene family. It is a multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid and on the surface of many cell types. It binds to vitamin D and its plasma metabolites and transports them to target tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene
Form : Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
Molecular Mass : 52.3kD
AA Sequence : LERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNILVDHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name GC group-specific component (vitamin D binding protein) [ Homo sapiens ]
Official Symbol GC
Synonyms GC; group-specific component (vitamin D binding protein); vitamin D-binding protein; DBP; hDBP; VDBP; VDB; gc-globulin; vitamin D-binding alpha-globulin; GRD3; VDBG; DBP/GC;
Gene ID 2638
mRNA Refseq NM_000583
Protein Refseq NP_000574
UniProt ID P02774

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GC Products

Required fields are marked with *

My Review for All GC Products

Required fields are marked with *

0
cart-icon