Recombinant Human GCG protein, His-tagged
Cat.No. : | GCG-20H |
Product Overview : | Recombinant Human GCG(Arg21-Lys180) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 21-180 a.a. |
Description : | Glucagon is a secreted protein and belongs to the glucagon family. Glucagon can be cleved into 8 chains, playing an important role in initiating and maintaining hyperglycemic conditions in diabetes. Glucagon can regulates blood glucose by decreasing glycolysis and increasing gluconeogenesis. In addition, Glucagon is involved in initiating and maintaining hyperglycemic conditions in diabetes. Glucagon release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. In the glucagon antagonist, His-53 and Phe-58 are missing. This antagonist has been successfully utilized to reduce glucose concentration in vivo. |
Form : | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,200mM NaCl,1mM DTT,50% Glycerol,pH 8.0. |
AA Sequence : | RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNR NNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGS FSDEMNTILDNLAARDFINWLIQTKITDRK |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Store at < -20 centigrade, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Gene Name | GCG glucagon [ Homo sapiens ] |
Official Symbol | GCG |
Synonyms | GCG; glucagon; glicentin related polypeptide; GLP1; GLP2; glucagon like peptide 1; glucagon like peptide 2; GRPP; glucagon-like peptide 1; glucagon-like peptide 2; glicentin-related polypeptide; |
Gene ID | 2641 |
mRNA Refseq | NM_002054 |
Protein Refseq | NP_002045 |
MIM | 138030 |
UniProt ID | P01275 |
Chromosome Location | 2q36-q37 |
Pathway | Class B/2 (Secretin family receptors), organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; FOXA1 transcription factor network, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; |
Function | glucagon receptor binding; hormone activity; receptor binding; |
◆ Recombinant Proteins | ||
GCG-2949H | Recombinant Human GCG protein, GST-tagged | +Inquiry |
GCG-3023H | Recombinant Human GCG Protein, His (Fc)-Avi-tagged | +Inquiry |
GCG-4969H | Recombinant Human GCG Protein, His-tagged | +Inquiry |
GCG-1451H | Recombinant Human GCG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Gcg-6744M | Recombinant Mouse Gcg protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCG-5990HCL | Recombinant Human GCG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GCG Products
Required fields are marked with *
My Review for All GCG Products
Required fields are marked with *