Recombinant Human GCH1

Cat.No. : GCH1-28280TH
Product Overview : Recombinant full length Human GTP cyclohydrolase 1 with N-terminal proprietary tag.Mol Wt 53.61 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 251 amino acids
Description : This gene encodes a member of the GTP cyclohydrolase family. The encoded protein is the first and rate-limiting enzyme in tetrahydrobiopterin (BH4) biosynthesis, catalyzing the conversion of GTP into 7,8-dihydroneopterin triphosphate. BH4 is an essential cofactor required by aromatic amino acid hydroxylases as well as nitric oxide synthases. Mutations in this gene are associated with malignant hyperphenylalaninemia and dopa-responsive dystonia. Several alternatively spliced transcript variants encoding different isoforms have been described; however, not all variants give rise to a functional enzyme.
Molecular Weight : 53.610kDa inclusive of tags
Tissue specificity : In epidermis, expressed predominantly in basal undifferentiated keratinocytes and in some but not all melanocytes (at protein level).
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPP RPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILS SLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDA IFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNK QVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPA GVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKT REEFLTLIRS
Sequence Similarities : Belongs to the GTP cyclohydrolase I family.
Gene Name GCH1 GTP cyclohydrolase 1 [ Homo sapiens ]
Official Symbol GCH1
Synonyms GCH1; GTP cyclohydrolase 1; dystonia 14 , DYT5, DYT14, GCH; dopa responsive dystonia; DYT5a; GTPCH1;
Gene ID 2643
mRNA Refseq NM_000161
Protein Refseq NP_000152
MIM 600225
Uniprot ID P30793
Chromosome Location 14q22.1-q22.2
Pathway Folate biosynthesis, organism-specific biosystem; Folate biosynthesis, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nitric oxide, organism-specific biosystem;
Function GTP binding; GTP cyclohydrolase I activity; NOT GTP cyclohydrolase I activity; GTP-dependent protein binding; calcium ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GCH1 Products

Required fields are marked with *

My Review for All GCH1 Products

Required fields are marked with *

0
cart-icon