Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human GCH1

Cat.No. : GCH1-28280TH
Product Overview : Recombinant full length Human GTP cyclohydrolase 1 with N-terminal proprietary tag.Mol Wt 53.61 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the GTP cyclohydrolase family. The encoded protein is the first and rate-limiting enzyme in tetrahydrobiopterin (BH4) biosynthesis, catalyzing the conversion of GTP into 7,8-dihydroneopterin triphosphate. BH4 is an essential cofactor required by aromatic amino acid hydroxylases as well as nitric oxide synthases. Mutations in this gene are associated with malignant hyperphenylalaninemia and dopa-responsive dystonia. Several alternatively spliced transcript variants encoding different isoforms have been described; however, not all variants give rise to a functional enzyme.
Protein length : 251 amino acids
Molecular Weight : 53.610kDa inclusive of tags
Source : Wheat germ
Tissue specificity : In epidermis, expressed predominantly in basal undifferentiated keratinocytes and in some but not all melanocytes (at protein level).
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPP RPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILS SLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDA IFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNK QVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPA GVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKT REEFLTLIRS
Sequence Similarities : Belongs to the GTP cyclohydrolase I family.
Gene Name : GCH1 GTP cyclohydrolase 1 [ Homo sapiens ]
Official Symbol : GCH1
Synonyms : GCH1; GTP cyclohydrolase 1; dystonia 14 , DYT5, DYT14, GCH; dopa responsive dystonia; DYT5a; GTPCH1;
Gene ID : 2643
mRNA Refseq : NM_000161
Protein Refseq : NP_000152
MIM : 600225
Uniprot ID : P30793
Chromosome Location : 14q22.1-q22.2
Pathway : Folate biosynthesis, organism-specific biosystem; Folate biosynthesis, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nitric oxide, organism-specific biosystem;
Function : GTP binding; GTP cyclohydrolase I activity; NOT GTP cyclohydrolase I activity; GTP-dependent protein binding; calcium ion binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends