Recombinant Human GCH1 Protein, GST-tagged
Cat.No. : | GCH1-4794H |
Product Overview : | Human GCH1 full-length ORF ( AAH25415.1, 1 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the GTP cyclohydrolase family. The encoded protein is the first and rate-limiting enzyme in tetrahydrobiopterin (BH4) biosynthesis, catalyzing the conversion of GTP into 7,8-dihydroneopterin triphosphate. BH4 is an essential cofactor required by aromatic amino acid hydroxylases as well as nitric oxide synthases. Mutations in this gene are associated with malignant hyperphenylalaninemia and dopa-responsive dystonia. Several alternatively spliced transcript variants encoding different isoforms have been described; however, not all variants give rise to a functional enzyme. [provided by RefSeq |
Molecular Mass : | 53.24 kDa |
AA Sequence : | MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GCH1 GTP cyclohydrolase 1 [ Homo sapiens ] |
Official Symbol | GCH1 |
Synonyms | GCH1; GTP cyclohydrolase 1; dystonia 14, DYT5, DYT14, GCH; dopa responsive dystonia; DYT5a; GTPCH1; GTP-CH-I; dystonia 14; GTP cyclohydrolase I; guanosine 5-triphosphate cyclohydrolase I; GCH; DYT5; DYT14; HPABH4B; GTP-CH-1; |
Gene ID | 2643 |
mRNA Refseq | NM_001024070 |
Protein Refseq | NP_001019241 |
MIM | 600225 |
UniProt ID | P30793 |
◆ Recombinant Proteins | ||
GCH1-3024H | Recombinant Human GCH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GCH1-6776C | Recombinant Chicken GCH1 | +Inquiry |
GCH1-4794H | Recombinant Human GCH1 Protein, GST-tagged | +Inquiry |
GCH1-2489R | Recombinant Rat GCH1 Protein | +Inquiry |
GCH1-28280TH | Recombinant Human GCH1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCH1-5988HCL | Recombinant Human GCH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GCH1 Products
Required fields are marked with *
My Review for All GCH1 Products
Required fields are marked with *
0
Inquiry Basket