Recombinant Human GCH1 Protein, GST-tagged
| Cat.No. : | GCH1-4794H |
| Product Overview : | Human GCH1 full-length ORF ( AAH25415.1, 1 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the GTP cyclohydrolase family. The encoded protein is the first and rate-limiting enzyme in tetrahydrobiopterin (BH4) biosynthesis, catalyzing the conversion of GTP into 7,8-dihydroneopterin triphosphate. BH4 is an essential cofactor required by aromatic amino acid hydroxylases as well as nitric oxide synthases. Mutations in this gene are associated with malignant hyperphenylalaninemia and dopa-responsive dystonia. Several alternatively spliced transcript variants encoding different isoforms have been described; however, not all variants give rise to a functional enzyme. [provided by RefSeq |
| Molecular Mass : | 53.24 kDa |
| AA Sequence : | MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GCH1 GTP cyclohydrolase 1 [ Homo sapiens ] |
| Official Symbol | GCH1 |
| Synonyms | GCH1; GTP cyclohydrolase 1; dystonia 14, DYT5, DYT14, GCH; dopa responsive dystonia; DYT5a; GTPCH1; GTP-CH-I; dystonia 14; GTP cyclohydrolase I; guanosine 5-triphosphate cyclohydrolase I; GCH; DYT5; DYT14; HPABH4B; GTP-CH-1; |
| Gene ID | 2643 |
| mRNA Refseq | NM_001024070 |
| Protein Refseq | NP_001019241 |
| MIM | 600225 |
| UniProt ID | P30793 |
| ◆ Recombinant Proteins | ||
| GCH1-801H | Recombinant Human GCH1 Protein, His-tagged | +Inquiry |
| GCH1-7210Z | Recombinant Zebrafish GCH1 | +Inquiry |
| GCH1-2197H | Recombinant Human GCH1 Protein, His-tagged | +Inquiry |
| GCH1-5170HF | Recombinant Full Length Human GCH1 Protein, GST-tagged | +Inquiry |
| GCH1-470H | Recombinant Human GCH1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GCH1-5988HCL | Recombinant Human GCH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GCH1 Products
Required fields are marked with *
My Review for All GCH1 Products
Required fields are marked with *



