Recombinant Human GCNT1
Cat.No. : | GCNT1-27452TH |
Product Overview : | Recombinant full length Human GCNT1 with N-terminal proprietary tag. Predicted MW 73.15kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 428 amino acids |
Description : | This gene is a member of the beta-1,6-N-acetylglucosaminyltransferase gene family. It is essential to the formation of Gal beta 1-3(GlcNAc beta 1-6)GalNAc structures and the core 2 O-glycan branch. The gene coding this enzyme was originally mapped to 9q21, but was later localized to 9q13. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
Molecular Weight : | 73.150kDa inclusive of tags |
Tissue specificity : | Highly expressed in activated T-lymphocytes and myeloid cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLRTLLRRRLFSYPTKYYFMVLVLSLITFSVLRIHQKPEF VSVRHLELAGENPSSDINCTKVLQGDVNEIQKVKLEILTV KFKKRPRWTPDDYINMTSDCSSFIKRRKYIVEPLSKEEAE FPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSED SYLAAVMGIASCFSNVFVASRLESVVYASWSRVQADLNCM KDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGEN NLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLET PLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDE YLWATIQRIPEVPGSLPASHKYDLSDMQAVARFVKWQYFE GDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFAN KFDVDVDLFAIQCLDEHLRHKALETLKH |
Sequence Similarities : | Belongs to the glycosyltransferase 14 family. |
Gene Name | GCNT1 glucosaminyl (N-acetyl) transferase 1, core 2 [ Homo sapiens ] |
Official Symbol | GCNT1 |
Synonyms | GCNT1; glucosaminyl (N-acetyl) transferase 1, core 2; glucosaminyl (N acetyl) transferase 1, core 2 (beta 1,6 N acetylglucosaminyltransferase) , NACGT2; beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase; beta 1; 3 galact |
Gene ID | 2650 |
mRNA Refseq | NM_001097633 |
Protein Refseq | NP_001091102 |
MIM | 600391 |
Uniprot ID | Q02742 |
Chromosome Location | 9q13 |
Pathway | Metabolic pathways, organism-specific biosystem; Mucin type O-Glycan biosynthesis, organism-specific biosystem; Mucin type O-Glycan biosynthesis, conserved biosystem; O-glycan biosynthesis, mucin type core, organism-specific biosystem; O-glycan biosynthesis, mucin type core, conserved biosystem; |
Function | beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity; transferase activity, transferring glycosyl groups; |
◆ Recombinant Proteins | ||
GCNT1-3025H | Recombinant Human GCNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GCNT1-4804H | Recombinant Human GCNT1 Protein, GST-tagged | +Inquiry |
GCNT1-27452TH | Recombinant Human GCNT1 | +Inquiry |
GCNT1-5185HF | Recombinant Full Length Human GCNT1 Protein, GST-tagged | +Inquiry |
GCNT1-714H | Active Recombinant Human GCNT1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCNT1-5980HCL | Recombinant Human GCNT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GCNT1 Products
Required fields are marked with *
My Review for All GCNT1 Products
Required fields are marked with *