Recombinant Human GCNT1
| Cat.No. : | GCNT1-27452TH | 
| Product Overview : | Recombinant full length Human GCNT1 with N-terminal proprietary tag. Predicted MW 73.15kDa. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | Non | 
| Protein Length : | 428 amino acids | 
| Description : | This gene is a member of the beta-1,6-N-acetylglucosaminyltransferase gene family. It is essential to the formation of Gal beta 1-3(GlcNAc beta 1-6)GalNAc structures and the core 2 O-glycan branch. The gene coding this enzyme was originally mapped to 9q21, but was later localized to 9q13. Multiple alternatively spliced variants, encoding the same protein, have been identified. | 
| Molecular Weight : | 73.150kDa inclusive of tags | 
| Tissue specificity : | Highly expressed in activated T-lymphocytes and myeloid cells. | 
| Form : | Liquid | 
| Purity : | Proprietary Purification | 
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | MLRTLLRRRLFSYPTKYYFMVLVLSLITFSVLRIHQKPEF VSVRHLELAGENPSSDINCTKVLQGDVNEIQKVKLEILTV KFKKRPRWTPDDYINMTSDCSSFIKRRKYIVEPLSKEEAE FPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSED SYLAAVMGIASCFSNVFVASRLESVVYASWSRVQADLNCM KDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGEN NLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLET PLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDE YLWATIQRIPEVPGSLPASHKYDLSDMQAVARFVKWQYFE GDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFAN KFDVDVDLFAIQCLDEHLRHKALETLKH | 
| Sequence Similarities : | Belongs to the glycosyltransferase 14 family. | 
| Gene Name | GCNT1 glucosaminyl (N-acetyl) transferase 1, core 2 [ Homo sapiens ] | 
| Official Symbol | GCNT1 | 
| Synonyms | GCNT1; glucosaminyl (N-acetyl) transferase 1, core 2; glucosaminyl (N acetyl) transferase 1, core 2 (beta 1,6 N acetylglucosaminyltransferase) , NACGT2; beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase; beta 1; 3 galact | 
| Gene ID | 2650 | 
| mRNA Refseq | NM_001097633 | 
| Protein Refseq | NP_001091102 | 
| MIM | 600391 | 
| Uniprot ID | Q02742 | 
| Chromosome Location | 9q13 | 
| Pathway | Metabolic pathways, organism-specific biosystem; Mucin type O-Glycan biosynthesis, organism-specific biosystem; Mucin type O-Glycan biosynthesis, conserved biosystem; O-glycan biosynthesis, mucin type core, organism-specific biosystem; O-glycan biosynthesis, mucin type core, conserved biosystem; | 
| Function | beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity; transferase activity, transferring glycosyl groups; | 
| ◆ Recombinant Proteins | ||
| GCNT1-3025H | Recombinant Human GCNT1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| GCNT1-4804H | Recombinant Human GCNT1 Protein, GST-tagged | +Inquiry | 
| GCNT1-27452TH | Recombinant Human GCNT1 | +Inquiry | 
| GCNT1-5185HF | Recombinant Full Length Human GCNT1 Protein, GST-tagged | +Inquiry | 
| GCNT1-714H | Active Recombinant Human GCNT1, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| GCNT1-5980HCL | Recombinant Human GCNT1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All GCNT1 Products
Required fields are marked with *
My Review for All GCNT1 Products
Required fields are marked with *
  
        
    
      
            