Recombinant Human GCNT2, His-tagged
Cat.No. : | GCNT2-89H |
Product Overview : | Recombinant Human N-Acetyllactosaminide β-1,6-N-Acetylglucosaminyl-Transferase Isoform C/GCNT2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Arg21-Phe402) of Human GCNT2 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 21-402 a.a. |
AA Sequence : | RFYSSQLSPPKSYEKLNSSSERYFRKTACNHALEKMPVFLWENILPSPLRSVPCKDYLTQNHYIT SPLSEEEAAFPLAYVMVIHKDFDTFERLFRAIYMPQNVYCVHVDEKAPAEYKESVRQLLSCFQNA FIASKTESVVYAGISRLQADLNCLKDLVASEVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNI TPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTREFVDFVLRD QRAIDLLQWSKDTYSPDEHFWVTLNRVSGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHG ICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYFLDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) [ Homo sapiens ] |
Official Symbol | GCNT2 |
Synonyms | GCNT2; glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group); cataract, congenital , CCAT, GCNT5, glucosaminyl (N acetyl) transferase 2, I branching enzyme , glucosaminyl (N acetyl) transferase 2, I branching enzyme (Ii blood group) , glucosaminyl (N acetyl) transferase 5 , II, NACGT1; N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase; bA360O19.2; bA421M1.1; IGNT; Ii blood group; NAGCT1; ULG3; unassigned linkage group 3; I beta-1,6-N-acetylglucosaminyltransferase; beta-1,6-N-acetylglucosaminyltransferase 2; II; CCAT; GCNT5; GCNT2C; NACGT1; MGC163396; |
Gene ID | 2651 |
mRNA Refseq | NM_001491 |
Protein Refseq | NP_001482 |
MIM | 600429 |
UniProt ID | Q06430 |
Chromosome Location | 6p24.2 |
Pathway | Glycosphingolipid biosynthesis - lacto and neolacto series, organism-specific biosystem; Glycosphingolipid biosynthesis - lacto and neolacto series, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function | N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity; transferase activity, transferring glycosyl groups; |
◆ Recombinant Proteins | ||
GCNT2-89H | Recombinant Human GCNT2, His-tagged | +Inquiry |
Gcnt2-3176M | Recombinant Mouse Gcnt2 Protein, Myc/DDK-tagged | +Inquiry |
GCNT2-10H | Active Recombinant Human GCNT2 Protein (AA 26-400), N-6×His/GFP tagged | +Inquiry |
GCNT2-667H | Recombinant Human GCNT2 Protein, MYC/DDK-tagged | +Inquiry |
GCNT2-01H | Active Recombinant Human GCNT2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCNT2-5979HCL | Recombinant Human GCNT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GCNT2 Products
Required fields are marked with *
My Review for All GCNT2 Products
Required fields are marked with *