Recombinant Human GCNT2 Protein, GST-tagged
| Cat.No. : | GCNT2-4805H |
| Product Overview : | Human GCNT2 full-length ORF ( NP_663630.2, 1 a.a. - 402 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes the enzyme responsible for formation of the blood group I antigen. The i and I antigens are distinguished by linear and branched poly-N-acetyllactosaminoglycans, respectively. The encoded protein is the I-branching enzyme, a beta-1,6-N-acetylglucosaminyltransferase responsible for the conversion of fetal i antigen to adult I antigen in erythrocytes during embryonic development. Mutations in this gene have been associated with adult i blood group phenotype. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq |
| Molecular Mass : | 72.9 kDa |
| AA Sequence : | MNFWRYCFFAFTLLSVVIFVRFYSSQLSPPKSYEKLNSSSERYFRKTACNHALEKMPVFLWENILPSPLRSVPCKDYLTQNHYITSPLSEEEAAFPLAYVMVIHKDFDTFERLFRAIYMPQNVYCVHVDEKAPAEYKESVRQLLSCFQNAFIASKTESVVYAGISRLQADLNCLKDLVASEVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTRDFVDFVLRDQRAIDLLQWSKDTYSPDEHFWVTLNRVSGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) [ Homo sapiens ] |
| Official Symbol | GCNT2 |
| Synonyms | GCNT2; glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group); cataract, congenital, CCAT, GCNT5, glucosaminyl (N acetyl) transferase 2, I branching enzyme, glucosaminyl (N acetyl) transferase 2, I branching enzyme (Ii blood group), glucosaminyl (N acetyl) transferase 5, II, NACGT1; N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase; bA360O19.2; bA421M1.1; IGNT; Ii blood group; NAGCT1; ULG3; unassigned linkage group 3; I beta-1,6-N-acetylglucosaminyltransferase; beta-1,6-N-acetylglucosaminyltransferase 2; II; CCAT; GCNT5; GCNT2C; NACGT1; MGC163396; |
| Gene ID | 2651 |
| mRNA Refseq | NM_001491 |
| Protein Refseq | NP_001482 |
| MIM | 600429 |
| UniProt ID | Q06430 |
| ◆ Recombinant Proteins | ||
| RFL3098MF | Recombinant Full Length Mouse N-Acetyllactosaminide Beta-1,6-N-Acetylglucosaminyl-Transferase(Gcnt2) Protein, His-Tagged | +Inquiry |
| GCNT2-89H | Recombinant Human GCNT2, His-tagged | +Inquiry |
| GCNT2-4805H | Recombinant Human GCNT2 Protein, GST-tagged | +Inquiry |
| GCNT2-5186HF | Recombinant Full Length Human GCNT2 Protein, GST-tagged | +Inquiry |
| Gcnt2-3176M | Recombinant Mouse Gcnt2 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GCNT2-5979HCL | Recombinant Human GCNT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GCNT2 Products
Required fields are marked with *
My Review for All GCNT2 Products
Required fields are marked with *
