Recombinant Full Length Mouse N-Acetyllactosaminide Beta-1,6-N-Acetylglucosaminyl-Transferase(Gcnt2) Protein, His-Tagged
Cat.No. : | RFL3098MF |
Product Overview : | Recombinant Full Length Mouse N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase(Gcnt2) Protein (P97402) (1-401aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-401) |
Form : | Lyophilized powder |
AA Sequence : | MPPSVRYFFIVSVTTVIVFIVLYVLSFGGDQSYQKLNISDSVMLAQVCSSFIDGKSRFLWRNKLMIHEKPSCTEYVTQSHYITAPLSQEEVDFPLAYVMVIHHNFDTFARLFRAIFMPQNIYCVHVDEKATAEFKGAVEQLVSCFPNAFLASKMEPVVYGGISRLQADLNCIKDLSTSEVPWKYAINTCGQDFPLKTNKEIVQYLKGLKGKNLTPGVLPPAHAIGRTRYVHREHLSKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLRDPRAVDLLHWSKDTFSPDEHFWVTLNRIPGVPGSMPPNASWTGNLRAVKWMDMEAKHGGCHGHYVHGICIYGNGDLQWLINSQSLFANKFELNTYPLTVECLELRLRERTLNQSEIAIQPSWYF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gcnt2 |
Synonyms | Gcnt2; N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase; N-acetylglucosaminyltransferase; I-branching enzyme; IGNT; Large I antigen-forming beta-1,6-N-acetylglucosaminyltransferase |
UniProt ID | P97402 |
◆ Recombinant Proteins | ||
GCNT2-01H | Active Recombinant Human GCNT2 protein, His-tagged | +Inquiry |
GCNT2-667H | Recombinant Human GCNT2 Protein, MYC/DDK-tagged | +Inquiry |
GCNT2-89H | Recombinant Human GCNT2, His-tagged | +Inquiry |
GCNT2-10H | Active Recombinant Human GCNT2 Protein (AA 26-400), N-6×His/GFP tagged | +Inquiry |
GCNT2-4805H | Recombinant Human GCNT2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCNT2-5979HCL | Recombinant Human GCNT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gcnt2 Products
Required fields are marked with *
My Review for All Gcnt2 Products
Required fields are marked with *
0
Inquiry Basket