Recombinant Human GCSH Protein, GST-tagged
Cat.No. : | GCSH-4809H |
Product Overview : | Human GCSH full-length ORF ( AAH00790.1, 1 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The enzyme system for cleavage of glycine (glycine cleavage system; EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase; MIM 238300), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme; MIM 238310), and L protein (a lipoamide dehydrogenase; MIM 238331). Glycine encephalopathy (GCE; MIM 605899), also called nonketotic hyperglycinemia (NKH), may be due to a defect in any one of these enzymes.[supplied by OMIM |
Molecular Mass : | 44.77 kDa |
AA Sequence : | MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GCSH glycine cleavage system protein H (aminomethyl carrier) [ Homo sapiens ] |
Official Symbol | GCSH |
Synonyms | GCSH; glycine cleavage system protein H (aminomethyl carrier); glycine cleavage system H protein, mitochondrial; lipoic acid containing protein; lipoic acid-containing protein; mitochondrial glycine cleavage system H-protein; GCE; NKH; |
Gene ID | 2653 |
mRNA Refseq | NM_004483 |
Protein Refseq | NP_004474 |
MIM | 238330 |
UniProt ID | P23434 |
◆ Recombinant Proteins | ||
GCSH-450H | Recombinant Human GCSH protein, His-tagged | +Inquiry |
GCSH-6276M | Recombinant Mouse GCSH Protein | +Inquiry |
GCSH-652H | Recombinant Human GCSH Protein, MYC/DDK-tagged | +Inquiry |
GCSH-6266H | Recombinant Human GCSH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GCSH-3514M | Recombinant Mouse GCSH Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCSH-5975HCL | Recombinant Human GCSH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GCSH Products
Required fields are marked with *
My Review for All GCSH Products
Required fields are marked with *
0
Inquiry Basket