Recombinant Human GDF15 Protein, GST-tagged

Cat.No. : GDF15-4822H
Product Overview : Human GDF15 full-length ORF ( AAH00529.1, 31 a.a. - 308 a.a.) recombinant protein with GST-tag at N-terminal.
Availability June 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Bone morphogenetic proteins (e.g., BMP5; MIM 112265) are members of the transforming growth factor-beta (see TGFB1; MIM 190180) superfamily and regulate tissue differentiation and maintenance. They are synthesized as precursor molecules that are processed at a dibasic cleavage site to release C-terminal domains containing a characteristic motif of 7 conserved cysteines in the mature protein.[supplied by OMIM
Molecular Mass : 56.21 kDa
AA Sequence : SLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GDF15 growth differentiation factor 15 [ Homo sapiens ]
Official Symbol GDF15
Synonyms GDF15; growth differentiation factor 15; growth/differentiation factor 15; MIC 1; MIC1; NAG 1; PDF; PLAB; prostate differentiation factor; PTGFB; NRG-1; PTGF-beta; placental TGF-beta; NSAID-activated gene 1 protein; NSAID-regulated gene 1 protein; macrophage inhibitory cytokine 1; placental bone morphogenetic protein; NSAID (nonsteroidal anti-inflammatory drug)-activated protein 1; MIC-1; NAG-1; GDF-15;
Gene ID 9518
mRNA Refseq NM_004864
Protein Refseq NP_004855
MIM 605312
UniProt ID Q99988

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GDF15 Products

Required fields are marked with *

My Review for All GDF15 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon