Recombinant Human GDF3 protein, His-tagged
Cat.No. : | GDF3-3659H |
Product Overview : | Recombinant Human GDF3 protein(251-355 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 251-355 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | AAIPVPKLSCKNLCHRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYED |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GDF3 growth differentiation factor 3 [ Homo sapiens ] |
Official Symbol | GDF3 |
Synonyms | GDF3; growth differentiation factor 3; growth/differentiation factor 3; GDF-3; KFS3; MCOP7; MCOPCB6; |
Gene ID | 9573 |
mRNA Refseq | NM_020634 |
Protein Refseq | NP_065685 |
MIM | 606522 |
UniProt ID | Q9NR23 |
◆ Recombinant Proteins | ||
GDF3-5238HF | Recombinant Full Length Human GDF3 Protein, GST-tagged | +Inquiry |
Gdf3-272M | Recombinant Mouse Gdf3 Protein, His-tagged | +Inquiry |
GDF3-6764C | Recombinant Chicken GDF3 | +Inquiry |
Gdf3-273R | Recombinant Rat Gdf3 Protein, His-tagged | +Inquiry |
GDF3-02H | Active Recombinant Human GDF3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDF3-5969HCL | Recombinant Human GDF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GDF3 Products
Required fields are marked with *
My Review for All GDF3 Products
Required fields are marked with *
0
Inquiry Basket