Recombinant Human GDI1 protein, His-tagged
| Cat.No. : | GDI1-2448H |
| Product Overview : | Recombinant Human GDI1 protein(1-209 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | November 20, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-209 aa |
| Tag : | N-His |
| Form : | Liquid in sterile PBS, pH7.4, 10% Glycerol, 0.3M Arginine. |
| Molecular Mass : | The protein has a calculated MW of 28 kDa. |
| Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
| Purity : | > 90 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.0 mg/ml. |
| Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MGSSHHHHHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRI |
| Gene Name | GDI1 GDP dissociation inhibitor 1 [ Homo sapiens ] |
| Official Symbol | GDI1 |
| Synonyms | GDI1; GDP dissociation inhibitor 1; GDIL, MRX41, MRX48; rab GDP dissociation inhibitor alpha; FLJ41411; mental retardation; X linked 41; X linked 48; OPHN2; rab GDP dissociation inhibitor; alpha; RABGDIA; XAP 4; GDI-1; protein XAP-4; rab GDI alpha; oligophrenin-2; mental retardation, X-linked 48; rab GDP-dissociation inhibitor, alpha; guanosine diphosphate dissociation inhibitor 1; 1A; GDIL; MRX41; MRX48; XAP-4; RABGD1A; |
| Gene ID | 2664 |
| mRNA Refseq | NM_001493 |
| Protein Refseq | NP_001484 |
| MIM | 300104 |
| UniProt ID | P31150 |
| ◆ Recombinant Proteins | ||
| GDI1-5244HF | Recombinant Full Length Human GDI1 Protein, GST-tagged | +Inquiry |
| GDI1-287C | Recombinant Cynomolgus Monkey GDI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GDI1-3524M | Recombinant Mouse GDI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GDI1-6291M | Recombinant Mouse GDI1 Protein | +Inquiry |
| GDI1-2787Z | Recombinant Zebrafish GDI1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GDI1-5965HCL | Recombinant Human GDI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDI1 Products
Required fields are marked with *
My Review for All GDI1 Products
Required fields are marked with *
