Recombinant Human GDI1 protein, His-tagged

Cat.No. : GDI1-2448H
Product Overview : Recombinant Human GDI1 protein(1-209 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability November 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-209 aa
Tag : N-His
Form : Liquid in sterile PBS, pH7.4, 10% Glycerol, 0.3M Arginine.
Molecular Mass : The protein has a calculated MW of 28 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.0 mg/ml.
Reconstitution : Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MGSSHHHHHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRI
Gene Name GDI1 GDP dissociation inhibitor 1 [ Homo sapiens ]
Official Symbol GDI1
Synonyms GDI1; GDP dissociation inhibitor 1; GDIL, MRX41, MRX48; rab GDP dissociation inhibitor alpha; FLJ41411; mental retardation; X linked 41; X linked 48; OPHN2; rab GDP dissociation inhibitor; alpha; RABGDIA; XAP 4; GDI-1; protein XAP-4; rab GDI alpha; oligophrenin-2; mental retardation, X-linked 48; rab GDP-dissociation inhibitor, alpha; guanosine diphosphate dissociation inhibitor 1; 1A; GDIL; MRX41; MRX48; XAP-4; RABGD1A;
Gene ID 2664
mRNA Refseq NM_001493
Protein Refseq NP_001484
MIM 300104
UniProt ID P31150

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GDI1 Products

Required fields are marked with *

My Review for All GDI1 Products

Required fields are marked with *

0
cart-icon
0
compare icon