Recombinant Human GDNF protein, Fc/His-tagged
Cat.No. : | GDNF-7293H |
Product Overview : | Recombinant Human GDNF(Phe20-Ile211) fused with Fc and His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc&His |
Protein Length : | Phe20-Ile211 |
Form : | Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4 |
AA Sequence : | FPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMA VLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSC DAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCIVDD IEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Shipping : | The product is shipped at ambient temperature. |
Gene Name | GDNF glial cell derived neurotrophic factor [ Homo sapiens ] |
Official Symbol | GDNF |
Synonyms | GDNF; glial cell derived neurotrophic factor; glial cell line-derived neurotrophic factor; astrocyte derived trophic factor; ATF1; ATF2; glial cell line derived neurotrophic factor; glial derived neurotrophic factor; HFB1 GDNF; ATF; astrocyte-derived trophic factor; HSCR3; HFB1-GDNF; |
Gene ID | 2668 |
mRNA Refseq | NM_000514 |
Protein Refseq | NP_000505 |
MIM | 600837 |
UniProt ID | P39905 |
Chromosome Location | 5p13.1-p12 |
Pathway | Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; NCAM signaling for neurite out-growth, organism-specific biosystem; NCAM1 interactions, organism-specific biosystem; Signaling events regulated by Ret tyrosine kinase, organism-specific biosystem; |
Function | growth factor activity; protein homodimerization activity; receptor binding; |
◆ Recombinant Proteins | ||
GDNF-338H | Recombinant Human Glial Cell Derived Neurotrophic Factor | +Inquiry |
GDNF-3525M | Recombinant Mouse GDNF Protein, His (Fc)-Avi-tagged | +Inquiry |
Gdnf-780R | Recombinant Rat Gdnf protein, His-tagged | +Inquiry |
GDNF-2955H | Recombinant Human GDNF protein, His-SUMO-tagged | +Inquiry |
Gdnf-30M | Recombinant Mouse Gdnf Protein (Ser78-Ile211), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDNF-1549HCL | Recombinant Human GDNF cell lysate | +Inquiry |
GDNF-400RCL | Recombinant Rat GDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDNF Products
Required fields are marked with *
My Review for All GDNF Products
Required fields are marked with *