Recombinant Human GDNF protein, His-SUMO-tagged
Cat.No. : | GDNF-2955H |
Product Overview : | Recombinant Human GDNF protein(P39905)(78-211aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 78-211aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.1 kDa |
AA Sequence : | SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GDNF glial cell derived neurotrophic factor [ Homo sapiens ] |
Official Symbol | GDNF |
Synonyms | GDNF; glial cell derived neurotrophic factor; glial cell line-derived neurotrophic factor; astrocyte derived trophic factor; ATF1; ATF2; glial cell line derived neurotrophic factor; glial derived neurotrophic factor; HFB1 GDNF; ATF; astrocyte-derived trophic factor; HSCR3; HFB1-GDNF; |
Gene ID | 2668 |
mRNA Refseq | NM_000514 |
Protein Refseq | NP_000505 |
MIM | 600837 |
UniProt ID | P39905 |
◆ Recombinant Proteins | ||
GDNF-985H | Active Recombinant Human GDNF | +Inquiry |
GDNF-4533H | Recombinant Human GDNF protein, For Organoid Culture | +Inquiry |
GDNF-338H | Recombinant Human Glial Cell Derived Neurotrophic Factor | +Inquiry |
GDNF-1066C | Recombinant Canine GDNF protein, hFc-tagged | +Inquiry |
Gdnf-595R | Recombinant Rat Gdnf protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDNF-1549HCL | Recombinant Human GDNF cell lysate | +Inquiry |
GDNF-400RCL | Recombinant Rat GDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDNF Products
Required fields are marked with *
My Review for All GDNF Products
Required fields are marked with *