Recombinant Human GEMIN4 Protein, GST-tagged
Cat.No. : | GEMIN4-4840H |
Product Overview : | Human GEMIN4 partial ORF ( NP_056536, 959 a.a. - 1057 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The product of this gene is part of a large complex localized to the cytoplasm, nucleoli, and to discrete nuclear bodies called Gemini bodies (gems). The complex functions in spliceosomal snRNP assembly in the cytoplasm, and regenerates spliceosomes required for pre-mRNA splicing in the nucleus. The encoded protein directly interacts with a DEAD box protein and several spliceosome core proteins. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | AAGPWVQGPEQDLTQEALFVYTQVFCHALHIMAMLHPEVCEPLYVLALETLTCYETLSKTNPSVSSLLQRAHEQRFLKSIAEGIGPEERRQTLLQKMSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GEMIN4 gem (nuclear organelle) associated protein 4 [ Homo sapiens ] |
Official Symbol | GEMIN4 |
Synonyms | GEMIN4; gem (nuclear organelle) associated protein 4; gem-associated protein 4; component of gems 4; DKFZP434B131; DKFZP434D174; HC56; HCAP1; HCC associated protein 1; HHRF 1; p97; gemin-4; HCC-associated protein 1; HHRF-1; DKFZp434B131; DKFZp434D174; |
Gene ID | 50628 |
mRNA Refseq | NM_015721 |
Protein Refseq | NP_056536 |
MIM | 606969 |
UniProt ID | P57678 |
◆ Recombinant Proteins | ||
GEMIN4-2654Z | Recombinant Zebrafish GEMIN4 | +Inquiry |
GEMIN4-4840H | Recombinant Human GEMIN4 Protein, GST-tagged | +Inquiry |
GEMIN4-5456C | Recombinant Chicken GEMIN4 | +Inquiry |
GEMIN4-13222H | Recombinant Human GEMIN4, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GEMIN4 Products
Required fields are marked with *
My Review for All GEMIN4 Products
Required fields are marked with *