Recombinant Human GEMIN4 Protein, GST-tagged

Cat.No. : GEMIN4-4840H
Product Overview : Human GEMIN4 partial ORF ( NP_056536, 959 a.a. - 1057 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The product of this gene is part of a large complex localized to the cytoplasm, nucleoli, and to discrete nuclear bodies called Gemini bodies (gems). The complex functions in spliceosomal snRNP assembly in the cytoplasm, and regenerates spliceosomes required for pre-mRNA splicing in the nucleus. The encoded protein directly interacts with a DEAD box protein and several spliceosome core proteins. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
Molecular Mass : 36.63 kDa
AA Sequence : AAGPWVQGPEQDLTQEALFVYTQVFCHALHIMAMLHPEVCEPLYVLALETLTCYETLSKTNPSVSSLLQRAHEQRFLKSIAEGIGPEERRQTLLQKMSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GEMIN4 gem (nuclear organelle) associated protein 4 [ Homo sapiens ]
Official Symbol GEMIN4
Synonyms GEMIN4; gem (nuclear organelle) associated protein 4; gem-associated protein 4; component of gems 4; DKFZP434B131; DKFZP434D174; HC56; HCAP1; HCC associated protein 1; HHRF 1; p97; gemin-4; HCC-associated protein 1; HHRF-1; DKFZp434B131; DKFZp434D174;
Gene ID 50628
mRNA Refseq NM_015721
Protein Refseq NP_056536
MIM 606969
UniProt ID P57678

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GEMIN4 Products

Required fields are marked with *

My Review for All GEMIN4 Products

Required fields are marked with *

0
cart-icon
0
compare icon