Recombinant Human GFER Protein, GST-tagged

Cat.No. : GFER-4849H
Product Overview : Human GFER full-length ORF ( AAH28348, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The hepatotrophic factor designated augmenter of liver regeneration (ALR) is thought to be one of the factors responsible for the extraordinary regenerative capacity of mammalian liver. It has also been called hepatic regenerative stimulation substance (HSS). The gene resides on chromosome 16 in the interval containing the locus for polycystic kidney disease (PKD1). The putative gene product is 42% similar to the scERV1 protein of yeast. The yeast scERV1 gene had been found to be essential for oxidative phosphorylation, the maintenance of mitochondrial genomes, and the cell division cycle. The human gene is both the structural and functional homolog of the yeast scERV1 gene. [provided by RefSeq
Molecular Mass : 39.49 kDa
AA Sequence : MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GFER growth factor, augmenter of liver regeneration [ Homo sapiens ]
Official Symbol GFER
Synonyms GFER; growth factor, augmenter of liver regeneration; growth factor, erv1 (S. cerevisiae) like (augmenter of liver regeneration); FAD-linked sulfhydryl oxidase ALR; ALR; ERV1; ERV1 homolog (S. cerevisiae); HERV1; HPO1; HPO2; HSS; ERV1 homolog; hepatopoietin protein; erv1-like growth factor; hepatic regenerative stimulation substance; HPO;
Gene ID 2671
mRNA Refseq NM_005262
Protein Refseq NP_005253
MIM 600924
UniProt ID P55789

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GFER Products

Required fields are marked with *

My Review for All GFER Products

Required fields are marked with *

0

Inquiry Basket

cartIcon