Recombinant Human GFER Protein, GST-tagged
Cat.No. : | GFER-4849H |
Product Overview : | Human GFER full-length ORF ( AAH28348, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The hepatotrophic factor designated augmenter of liver regeneration (ALR) is thought to be one of the factors responsible for the extraordinary regenerative capacity of mammalian liver. It has also been called hepatic regenerative stimulation substance (HSS). The gene resides on chromosome 16 in the interval containing the locus for polycystic kidney disease (PKD1). The putative gene product is 42% similar to the scERV1 protein of yeast. The yeast scERV1 gene had been found to be essential for oxidative phosphorylation, the maintenance of mitochondrial genomes, and the cell division cycle. The human gene is both the structural and functional homolog of the yeast scERV1 gene. [provided by RefSeq |
Molecular Mass : | 39.49 kDa |
AA Sequence : | MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GFER growth factor, augmenter of liver regeneration [ Homo sapiens ] |
Official Symbol | GFER |
Synonyms | GFER; growth factor, augmenter of liver regeneration; growth factor, erv1 (S. cerevisiae) like (augmenter of liver regeneration); FAD-linked sulfhydryl oxidase ALR; ALR; ERV1; ERV1 homolog (S. cerevisiae); HERV1; HPO1; HPO2; HSS; ERV1 homolog; hepatopoietin protein; erv1-like growth factor; hepatic regenerative stimulation substance; HPO; |
Gene ID | 2671 |
mRNA Refseq | NM_005262 |
Protein Refseq | NP_005253 |
MIM | 600924 |
UniProt ID | P55789 |
◆ Recombinant Proteins | ||
GFER-491H | Recombinant Human GFER Protein | +Inquiry |
GFER-1412H | Recombinant Human GFER Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GFER-2165R | Recombinant Rat GFER Protein, His (Fc)-Avi-tagged | +Inquiry |
GFER-1225R | Recombinant Rat GFER Protein, His-SUMO-tagged | +Inquiry |
GFER-205H | Recombinant Human GFER, His-SUMO-tagged, C13&N15 Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GFER-5954HCL | Recombinant Human GFER 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GFER Products
Required fields are marked with *
My Review for All GFER Products
Required fields are marked with *