Recombinant Rat GFER Protein, His-SUMO-tagged
| Cat.No. : | GFER-1225R |
| Product Overview : | Recombinant Rat GFER Protein (1-198aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-198 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 38.8 kDa |
| AA Sequence : | MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHGKRPCRACVDF KSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAE DIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Gfer growth factor, augmenter of liver regeneration [ Rattus norvegicus ] |
| Official Symbol | GFER |
| Synonyms | GFER; FAD-linked sulfhydryl oxidase ALR; Augmenter of liver regeneration; EC 1.8.3.2; growth factor; augmenter of liver regeneration |
| Gene ID | 27100 |
| mRNA Refseq | NM_013222.2 |
| Protein Refseq | NP_037354.2 |
| UniProt ID | Q63042 |
| ◆ Recombinant Proteins | ||
| GFER-216H | Recombinant Human GFER, His-SUMO-tagged | +Inquiry |
| GFER-205H | Recombinant Human GFER, His-SUMO-tagged, C13&N15 Labeled | +Inquiry |
| GFER-1412H | Recombinant Human GFER Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Gfer-587M | Recombinant Mouse Gfer Protein, MYC/DDK-tagged | +Inquiry |
| GFER-27232TH | Recombinant Human GFER | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GFER-5954HCL | Recombinant Human GFER 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GFER Products
Required fields are marked with *
My Review for All GFER Products
Required fields are marked with *
