Recombinant Rat GFER Protein, His-SUMO-tagged
Cat.No. : | GFER-1225R |
Product Overview : | Recombinant Rat GFER Protein (1-198aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-198 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 38.8 kDa |
AA Sequence : | MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHGKRPCRACVDF KSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAE DIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Gfer growth factor, augmenter of liver regeneration [ Rattus norvegicus ] |
Official Symbol | GFER |
Synonyms | GFER; FAD-linked sulfhydryl oxidase ALR; Augmenter of liver regeneration; EC 1.8.3.2; growth factor; augmenter of liver regeneration |
Gene ID | 27100 |
mRNA Refseq | NM_013222.2 |
Protein Refseq | NP_037354.2 |
UniProt ID | Q63042 |
◆ Recombinant Proteins | ||
GFER-3536M | Recombinant Mouse GFER Protein, His (Fc)-Avi-tagged | +Inquiry |
GFER-216H | Recombinant Human GFER, His-SUMO-tagged | +Inquiry |
GFER-1225R | Recombinant Rat GFER Protein, His-SUMO-tagged | +Inquiry |
GFER-4849H | Recombinant Human GFER Protein, GST-tagged | +Inquiry |
GFER-7080H | Recombinant Human GFER, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GFER-5954HCL | Recombinant Human GFER 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GFER Products
Required fields are marked with *
My Review for All GFER Products
Required fields are marked with *
0
Inquiry Basket