Recombinant Human GFRA2 Protein, His-tagged

Cat.No. : GFRA2-266H
Product Overview : Recombinant human GFRA2 protein with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 464
Description : Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This encoded protein acts preferentially as a receptor for NTN compared to its other family member, GDNF family receptor alpha 1. This gene is a candidate gene for RET-associated diseases. Multiple transcript variants encoding different isoforms have been found for this gene.
Form : Lyophilized
Molecular Mass : 47.6 kDa
AA Sequence : MILANVFCLFFFLDETLRSLASPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSGPSRARPSAALTVLSVLMLKLAL
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name GFRA2 GDNF family receptor alpha 2 [ Homo sapiens (human) ]
Official Symbol GFRA2
Synonyms GFRA2; GDNF family receptor alpha 2; GDNF family receptor alpha-2; GDNFRB; NTNRA; RETL2; TRNR2; GDNFR-beta; NTNR-alpha; GFR-alpha 2; RET ligand 2; GDNFR-alpha-2; GDNF receptor beta; neurturin receptor alpha; TRN receptor, GPI-anchored; PI-linked cell-surface accessory protein; TGF-beta-related neurotrophic factor receptor 2; glial cell line derived neurotrophic factor receptor, beta; NRTNR-ALPHA;
Gene ID 2675
mRNA Refseq NM_001165038
Protein Refseq NP_001158510
MIM 601956
UniProt ID O00451

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GFRA2 Products

Required fields are marked with *

My Review for All GFRA2 Products

Required fields are marked with *

0
cart-icon