Recombinant Human GFRA2 Protein, His-tagged
| Cat.No. : | GFRA2-266H |
| Product Overview : | Recombinant human GFRA2 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 464 |
| Description : | Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This encoded protein acts preferentially as a receptor for NTN compared to its other family member, GDNF family receptor alpha 1. This gene is a candidate gene for RET-associated diseases. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Form : | Lyophilized |
| Molecular Mass : | 47.6 kDa |
| AA Sequence : | MILANVFCLFFFLDETLRSLASPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSGPSRARPSAALTVLSVLMLKLAL |
| Purity : | > 98% |
| Applications : | WB; ELISA; FACS; FC |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Gene Name | GFRA2 GDNF family receptor alpha 2 [ Homo sapiens (human) ] |
| Official Symbol | GFRA2 |
| Synonyms | GFRA2; GDNF family receptor alpha 2; GDNF family receptor alpha-2; GDNFRB; NTNRA; RETL2; TRNR2; GDNFR-beta; NTNR-alpha; GFR-alpha 2; RET ligand 2; GDNFR-alpha-2; GDNF receptor beta; neurturin receptor alpha; TRN receptor, GPI-anchored; PI-linked cell-surface accessory protein; TGF-beta-related neurotrophic factor receptor 2; glial cell line derived neurotrophic factor receptor, beta; NRTNR-ALPHA; |
| Gene ID | 2675 |
| mRNA Refseq | NM_001165038 |
| Protein Refseq | NP_001158510 |
| MIM | 601956 |
| UniProt ID | O00451 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GFRA2 Products
Required fields are marked with *
My Review for All GFRA2 Products
Required fields are marked with *
