Recombinant Human GFRA2 protein, His-tagged

Cat.No. : GFRA2-2169H
Product Overview : Recombinant Human GFRA2 protein(22-441 aa), fused with C-terminal His tag, was expressed in HEK293.
Availability September 28, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 22-441 aa
Tag : C-His
Form : Liquid in sterile PBS, pH7.4.
Molecular Mass : The recombinant human GFRα2 consists of 431 amino acids after removal of the signal peptide and predicts a molecular mass of 48.2 kDa. As a result of glycosylation, the apparent molecular mass of rhGFRα2 is approximately 60-70 kDa in SDS-PAGE under reducing conditions.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.0 mg/ml.
Reconstitution : Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSAHHHHHHHHHH
Gene Name GFRA2 GDNF family receptor alpha 2 [ Homo sapiens ]
Official Symbol GFRA2
Synonyms GFRA2; GDNF family receptor alpha 2; GDNF family receptor alpha-2; GDNFRB; NTNRA; RETL2; TRNR2; GDNFR-beta; NTNR-alpha; GFR-alpha 2; RET ligand 2; GDNFR-alpha-2; GDNF receptor beta; neurturin receptor alpha; TRN receptor, GPI-anchored; PI-linked cell-surface accessory protein; TGF-beta-related neurotrophic factor receptor 2; glial cell line derived neurotrophic factor receptor, beta; NRTNR-ALPHA;
Gene ID 2675
mRNA Refseq NM_001165038
Protein Refseq NP_001158510
MIM 601956
UniProt ID O00451

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GFRA2 Products

Required fields are marked with *

My Review for All GFRA2 Products

Required fields are marked with *

0
cart-icon
0
compare icon