Recombinant Human GFRA2 protein, His-tagged
| Cat.No. : | GFRA2-2169H |
| Product Overview : | Recombinant Human GFRA2 protein(22-441 aa), fused with C-terminal His tag, was expressed in HEK293. |
| Availability | December 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 22-441 aa |
| Tag : | C-His |
| Form : | Liquid in sterile PBS, pH7.4. |
| Molecular Mass : | The recombinant human GFRα2 consists of 431 amino acids after removal of the signal peptide and predicts a molecular mass of 48.2 kDa. As a result of glycosylation, the apparent molecular mass of rhGFRα2 is approximately 60-70 kDa in SDS-PAGE under reducing conditions. |
| Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
| Purity : | > 90 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.0 mg/ml. |
| Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSAHHHHHHHHHH |
| Gene Name | GFRA2 GDNF family receptor alpha 2 [ Homo sapiens ] |
| Official Symbol | GFRA2 |
| Synonyms | GFRA2; GDNF family receptor alpha 2; GDNF family receptor alpha-2; GDNFRB; NTNRA; RETL2; TRNR2; GDNFR-beta; NTNR-alpha; GFR-alpha 2; RET ligand 2; GDNFR-alpha-2; GDNF receptor beta; neurturin receptor alpha; TRN receptor, GPI-anchored; PI-linked cell-surface accessory protein; TGF-beta-related neurotrophic factor receptor 2; glial cell line derived neurotrophic factor receptor, beta; NRTNR-ALPHA; |
| Gene ID | 2675 |
| mRNA Refseq | NM_001165038 |
| Protein Refseq | NP_001158510 |
| MIM | 601956 |
| UniProt ID | O00451 |
| ◆ Recombinant Proteins | ||
| GFRA2-893H | Active Recombinant Human GFRA2 Protein, Fc Chimera | +Inquiry |
| GFRA2-1524R | Active Recombinant Rhesus macaque GFRA2 protein, His-tagged | +Inquiry |
| Gfra2-360M | Recombinant Mouse Gfra2 Protein, His-tagged | +Inquiry |
| GFRA2-81H | Recombinant Human GFRA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GFRA2-713H | Recombinant Human GFRA2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GFRA2-2408MCL | Recombinant Mouse GFRA2 cell lysate | +Inquiry |
| GFRA2-2425HCL | Recombinant Human GFRA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GFRA2 Products
Required fields are marked with *
My Review for All GFRA2 Products
Required fields are marked with *
