Recombinant Human GFRA2 protein, His-tagged
Cat.No. : | GFRA2-2169H |
Product Overview : | Recombinant Human GFRA2 protein(22-441 aa), fused with C-terminal His tag, was expressed in HEK293. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 22-441 aa |
Tag : | C-His |
Form : | Liquid in sterile PBS, pH7.4. |
Molecular Mass : | The recombinant human GFRα2 consists of 431 amino acids after removal of the signal peptide and predicts a molecular mass of 48.2 kDa. As a result of glycosylation, the apparent molecular mass of rhGFRα2 is approximately 60-70 kDa in SDS-PAGE under reducing conditions. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.0 mg/ml. |
Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSAHHHHHHHHHH |
Gene Name | GFRA2 GDNF family receptor alpha 2 [ Homo sapiens ] |
Official Symbol | GFRA2 |
Synonyms | GFRA2; GDNF family receptor alpha 2; GDNF family receptor alpha-2; GDNFRB; NTNRA; RETL2; TRNR2; GDNFR-beta; NTNR-alpha; GFR-alpha 2; RET ligand 2; GDNFR-alpha-2; GDNF receptor beta; neurturin receptor alpha; TRN receptor, GPI-anchored; PI-linked cell-surface accessory protein; TGF-beta-related neurotrophic factor receptor 2; glial cell line derived neurotrophic factor receptor, beta; NRTNR-ALPHA; |
Gene ID | 2675 |
mRNA Refseq | NM_001165038 |
Protein Refseq | NP_001158510 |
MIM | 601956 |
UniProt ID | O00451 |
◆ Recombinant Proteins | ||
GFRA2-2814H | Recombinant Human GFRA2 Protein (Ser22-Ser441), C-His tagged | +Inquiry |
GFRA2-2169H | Recombinant Human GFRA2 protein, His-tagged | +Inquiry |
Gfra2-1742M | Recombinant Mouse Gfra2 | +Inquiry |
GFRA2-2815H | Recombinant Human GFRA2 Protein (Ser22-Ser441), C-His Fc tagged | +Inquiry |
GFRA2-359H | Recombinant Human GFRA2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GFRA2-2425HCL | Recombinant Human GFRA2 cell lysate | +Inquiry |
GFRA2-2408MCL | Recombinant Mouse GFRA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GFRA2 Products
Required fields are marked with *
My Review for All GFRA2 Products
Required fields are marked with *