Recombinant Human GGCX Protein, GST-tagged
Cat.No. : | GGCX-4870H |
Product Overview : | Human GGCX partial ORF ( NP_000812, 533 a.a. - 629 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an enzyme which catalyzes the posttranslational modification of vitamin K-dependent protein. Many of these vitamin K-dependent proteins are involved in coagulation so the function of the encoded enzyme is essential for hemostasis. Mutations in this gene are associated with vitamin K-dependent coagulation defect and PXE-like disorder with multiple coagulation factor deficiency. Multiple transcript variants encoding different isoforms have been found for this gene |
Molecular Mass : | 36.41 kDa |
AA Sequence : | ADFPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GGCX gamma-glutamyl carboxylase [ Homo sapiens ] |
Official Symbol | GGCX |
Synonyms | GGCX; gamma-glutamyl carboxylase; vitamin K-dependent gamma-carboxylase; vitamin K dependent gamma carboxylase; VKCFD1; peptidyl-glutamate 4-carboxylase; FLJ26629; |
Gene ID | 2677 |
mRNA Refseq | NM_000821 |
Protein Refseq | NP_000812 |
MIM | 137167 |
UniProt ID | P38435 |
◆ Recombinant Proteins | ||
GGCX-1838R | Recombinant Rhesus monkey GGCX Protein, His-tagged | +Inquiry |
GGCX-1659R | Recombinant Rhesus Macaque GGCX Protein, His (Fc)-Avi-tagged | +Inquiry |
GGCX-13240H | Recombinant Human GGCX, GST-tagged | +Inquiry |
GGCX-4870H | Recombinant Human GGCX Protein, GST-tagged | +Inquiry |
RFL10648HF | Recombinant Full Length Human Vitamin K-Dependent Gamma-Carboxylase(Ggcx) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GGCX-5949HCL | Recombinant Human GGCX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GGCX Products
Required fields are marked with *
My Review for All GGCX Products
Required fields are marked with *