Recombinant Human GH1 Protein, C-His-tagged
| Cat.No. : | GH1-05H |
| Product Overview : | Recombinant Human GH1 Protein with a C-His tag was expressed in E. coli. |
| Availability | December 03, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature. |
| Molecular Mass : | ~18.1KDa, reducing conditions |
| AA Sequence : | MFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFLEHHHHHH |
| Purity : | >90%, by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.12 mg/mL |
| Storage Buffer : | Supplied as a 0.2 μm filtered solution in 20 mM Tris, 300 mM NaCl, pH 8.0 |
| Publications : |
Development of a microplate duplex immunoassay to simplify detection of growth hormone doping: Proof of concept (2022)
|
| Gene Name | GH1 growth hormone 1 [ Homo sapiens (human) ] |
| Official Symbol | GH1 |
| Synonyms | GH1; growth hormone 1; GH; GHN; GH-N; GHB5; IGHD2; hGH-N; IGHD1A; IGHD1B; somatotropin; growth hormone B5; pituitary growth hormone |
| Gene ID | 2688 |
| mRNA Refseq | NM_000515 |
| Protein Refseq | NP_000506 |
| MIM | 139250 |
| UniProt ID | P01241 |
| ◆ Recombinant Proteins | ||
| GH1-109H | Recombinant Human GH1 Protein, His-tagged(C-ter) | +Inquiry |
| GH1-382H | Recombinant Human Growth Hormone 1, His-tagged | +Inquiry |
| GH1-241H | Active Recombinant Human GH1 (1-217aa) | +Inquiry |
| GH1-183B | Recombinant Bovine Growth Hormone | +Inquiry |
| GH1-782H | Active Recombinant Human GH1 protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| GH1-5354H | Native Human Growth Hormone 1 | +Inquiry |
| GH1-8147H | Native Growth Hormone (GH) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GH1-5944HCL | Recombinant Human GH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GH1 Products
Required fields are marked with *
My Review for All GH1 Products
Required fields are marked with *
