Recombinant Human GH1 Protein, C-His-tagged

Cat.No. : GH1-05H
Product Overview : Recombinant Human GH1 Protein with a C-His tag was expressed in E. coli.
Availability December 16, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature.
Molecular Mass : ~18.1KDa, reducing conditions
AA Sequence : MFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFLEHHHHHH
Purity : >90%, by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.12 mg/mL
Storage Buffer : Supplied as a 0.2 μm filtered solution in 20 mM Tris, 300 mM NaCl, pH 8.0
Publications :
Development of a microplate duplex immunoassay to simplify detection of growth hormone doping: Proof of concept (2022)
Gene Name GH1 growth hormone 1 [ Homo sapiens (human) ]
Official Symbol GH1
Synonyms GH1; growth hormone 1; GH; GHN; GH-N; GHB5; IGHD2; hGH-N; IGHD1A; IGHD1B; somatotropin; growth hormone B5; pituitary growth hormone
Gene ID 2688
mRNA Refseq NM_000515
Protein Refseq NP_000506
MIM 139250
UniProt ID P01241

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GH1 Products

Required fields are marked with *

My Review for All GH1 Products

Required fields are marked with *

0
cart-icon
0
compare icon