Recombinant Human Growth Hormone 1, His-tagged
Cat.No. : | GH1-382H |
Product Overview : | RecombinantHuman GH1 is a protein composed of 22.9 kDa, 205 amino residues and itcontains a 6-His-tag at the N-terminal end and is purified by sequentialchromatography. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | His |
Description : | GH1 is a member ofthe somatotropin / prolactin family of hormones which play an important rolein growth control. |
Form : | Lyophilized from aPBS 0.05M buffer at pH 7.5. |
Purity : | > 97% by SDS-PAGEgel |
M.W : | 22.9 kDa |
Endotoxin Level : | < 0.04 EU/μgprotein (LAL method) |
Sequence : | HHHHHHFPTIPLSRPFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREE TQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIF KQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFAG |
p.I : | 5.98 |
Extinction coeff : | E0.1% = 0.77 (A 280nm) |
Reconstitution Recommendation : | Lyophilized proteinshould be reconstituted in water to a concentration of 50 ng/μl. |
Biological Activity : | ED50 ≤ 0.04-0.1ng/mL. The biologica activity of human Growth Hormone is measured by cellproliferation using Nb2-11 cells. |
Storage : | This lyophilizedpreparation is stable at 2-8ºC. For long storage should be kept at -20ºC andit is recommended to add a carrier protein (0.1% HAS or BSA). Repeatedfreezing and thawing is not recommended. |
OfficialSymbol : | GH1 |
Pathways : | Adipogenesis;Cytokine Signaling in Immune system; Cytokine-cytokine receptor interaction;Diabetes pathways; Endochondral Ossification; Growth hormone receptorsignaling; Immune System; Jak-STAT signaling pathway; Neuroactiveligand-receptor interaction; Synthesis, Secretion, and Deacylation of Ghrelin |
Gene Name | GH1 growth hormone 1 [ Homosapiens ] |
Synonyms | GH1;growth hormone 1; GH; GHN; GH-N; hGH-N; IGHD1B; somatotropin; pituitarygrowth hormone; Somatotropin; Growth hormone; Growth hormone 1; Pituitarygrowth hormone |
Gene ID | 2688 |
mRNA Refseq | NM_000515 |
Protein Refseq | NP_000506 |
MIM | 139250 |
UniProt ID | P01241 |
Chromosome Location | 17q22-q24 |
Function | growth factoractivity; growth hormone receptor binding; hormone activity; metal ionbinding; prolactin receptor binding; protein binding |
◆ Recombinant Proteins | ||
GH1-002N | Recombinant Human Growth Hormone 1 (Active) , His-tagged | +Inquiry |
GH1-2514H | Recombinant Human GH1 protein(27-217 aa), N-MBP & C-His-tagged | +Inquiry |
GH1-6855H | Recombinant Human GH1 protein, His&Avi-tagged, Biotinylated | +Inquiry |
GH1-641H | Active Recombinant Human Growth Hormone 1 | +Inquiry |
GH1-277G | Active Recombinant Human GH1 Protein | +Inquiry |
◆ Native Proteins | ||
GH1-5354H | Native Human Growth Hormone 1 | +Inquiry |
GH1-8147H | Native Growth Hormone (GH) | +Inquiry |
◆ Cell & Tissue Lysates | ||
GH1-5944HCL | Recombinant Human GH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GH1 Products
Required fields are marked with *
My Review for All GH1 Products
Required fields are marked with *
0
Inquiry Basket