Recombinant Human GH2 Protein, GST-tagged

Cat.No. : GH2-4884H
Product Overview : Human GH2 full-length ORF ( AAH20760.1, 27 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. As in the case of its pituitary counterpart, growth hormone 1, the predominant isoform of this particular family member shows similar somatogenic activity, with reduced lactogenic activity. Mutations in this gene lead to placental growth hormone/lactogen deficiency. [provided by RefSeq
Molecular Mass : 46.75 kDa
AA Sequence : FPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEAYILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLRSVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GH2 growth hormone 2 [ Homo sapiens ]
Official Symbol GH2
Synonyms GH2; growth hormone 2; growth hormone variant; GH V; GHL; GHV; hGH V; placenta specific growth hormone; placental specific growth hormone; placenta-specific growth hormone; placental-specific growth hormone; GH-V; hGH-V;
Gene ID 2689
mRNA Refseq NM_002059
Protein Refseq NP_002050
MIM 139240
UniProt ID P01242

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GH2 Products

Required fields are marked with *

My Review for All GH2 Products

Required fields are marked with *

0
cart-icon
0
compare icon