Recombinant Human GHRHR Protein, GST-tagged
Cat.No. : | GHRHR-4891H |
Product Overview : | Human GHRHR partial ORF ( NP_000814, 23 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene, expressed in the pituitary, encodes a receptor for growth hormone-releasing hormone. Binding of this hormone to the receptor leads to synthesis and release of growth hormone. Mutations in this gene have been associated with isolated growth hormone deficiency (IGHD), also known as Dwarfism of Sindh, a disorder characterized by short stature. Many alternate transcriptional splice variants encoding different isoforms have been described, but only two have been characterized to date. [provided by RefSeq |
Molecular Mass : | 37.84 kDa |
AA Sequence : | HMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEESYFSTVKII |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GHRHR growth hormone releasing hormone receptor [ Homo sapiens ] |
Official Symbol | GHRHR |
Synonyms | GHRHR; growth hormone releasing hormone receptor; growth hormone-releasing hormone receptor; GRF receptor; GHRH receptor; GRFR; GHRFR; IGHD1B; |
Gene ID | 2692 |
mRNA Refseq | NM_000823 |
Protein Refseq | NP_000814 |
MIM | 139191 |
UniProt ID | Q02643 |
◆ Recombinant Proteins | ||
GHRHR-3551M | Recombinant Mouse GHRHR Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL29079MF | Recombinant Full Length Mouse Growth Hormone-Releasing Hormone Receptor(Ghrhr) Protein, His-Tagged | +Inquiry |
GHRHR-2541H | Recombinant Human GHRHR Protein (His23-Lys130), N-GST tagged | +Inquiry |
GHRHR-3303C | Recombinant Chicken GHRHR | +Inquiry |
Ghrhr-1576M | Recombinant Mouse Ghrhr Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GHRHR Products
Required fields are marked with *
My Review for All GHRHR Products
Required fields are marked with *
0
Inquiry Basket