Recombinant Human GHRHR Protein, GST-tagged

Cat.No. : GHRHR-4891H
Product Overview : Human GHRHR partial ORF ( NP_000814, 23 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene, expressed in the pituitary, encodes a receptor for growth hormone-releasing hormone. Binding of this hormone to the receptor leads to synthesis and release of growth hormone. Mutations in this gene have been associated with isolated growth hormone deficiency (IGHD), also known as Dwarfism of Sindh, a disorder characterized by short stature. Many alternate transcriptional splice variants encoding different isoforms have been described, but only two have been characterized to date. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : HMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEESYFSTVKII
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GHRHR growth hormone releasing hormone receptor [ Homo sapiens ]
Official Symbol GHRHR
Synonyms GHRHR; growth hormone releasing hormone receptor; growth hormone-releasing hormone receptor; GRF receptor; GHRH receptor; GRFR; GHRFR; IGHD1B;
Gene ID 2692
mRNA Refseq NM_000823
Protein Refseq NP_000814
MIM 139191
UniProt ID Q02643

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GHRHR Products

Required fields are marked with *

My Review for All GHRHR Products

Required fields are marked with *

0
cart-icon
0
compare icon