Recombinant Human GINS2 protein, T7-tagged

Cat.No. : GINS2-153H
Product Overview : Recombinant human GINS2 ( 185aa ) protein fused with T7 Tag (17aa)at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 185 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGEFGSMDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKC RLLPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSAD SFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLESTQSQDF
Purity : >90% by SDS-PAGE
Applications : 1. May be used for mapping GINS2 protein – protein interaction assay.2. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. Potential biomarker protein for breast cancer diagnosis.4. May be used for specific antibody production.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name GINS2 GINS complex subunit 2 (Psf2 homolog) [ Homo sapiens ]
Official Symbol GINS2
Synonyms GINS2; GINS complex subunit 2 (Psf2 homolog); DNA replication complex GINS protein PSF2; Pfs2; PSF2; HSPC037;
Gene ID 51659
mRNA Refseq NM_016095
Protein Refseq NP_057179
MIM 610609
UniProt ID Q9Y248
Chromosome Location 16q24.1
Pathway Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; DNA strand elongation, organism-specific biosystem; GINS complex, organism-specific biosystem; S Phase, organism-specific biosystem; Synthesis of DNA, organism-specific biosystem;
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GINS2 Products

Required fields are marked with *

My Review for All GINS2 Products

Required fields are marked with *

0
cart-icon