Recombinant Human GIP protein, GST-tagged
| Cat.No. : | GIP-13264H |
| Product Overview : | Recombinant Human GIP protein(22-153 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | February 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 22-153 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALELASQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLACLLDQTNLCRLRSR |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | GIP gastric inhibitory polypeptide [ Homo sapiens ] |
| Official Symbol | GIP |
| Synonyms | GIP; gastric inhibitory polypeptide; glucose dependent insulinotropic polypeptide; glucose-dependent insulinotropic polypeptide; |
| Gene ID | 2695 |
| mRNA Refseq | NM_004123 |
| Protein Refseq | NP_004114 |
| MIM | 137240 |
| UniProt ID | P09681 |
| ◆ Recombinant Proteins | ||
| GIPR-001S | Synthetic Gastric Inhibitory Peptide | +Inquiry |
| GIP-1568HFL | Recombinant Full Length Human GIP Protein, C-Flag-tagged | +Inquiry |
| GIP-981H | Recombinant Human GIP Protein, His (Fc)-Avi-tagged | +Inquiry |
| Gip-7871R | Recombinant Rat Gip protein, His & GST-tagged | +Inquiry |
| GIP-4581H | Recombinant Human GIP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GIP-5930HCL | Recombinant Human GIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GIP Products
Required fields are marked with *
My Review for All GIP Products
Required fields are marked with *
