Recombinant Human GIPR protein, His&Myc-tagged
| Cat.No. : | GIPR-2220H |
| Product Overview : | Recombinant Human GIPR protein(P48546)(22-138aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His&Myc |
| Protein Length : | 22-138aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 17.3 kDa |
| AA Sequence : | RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | GIPR gastric inhibitory polypeptide receptor [ Homo sapiens ] |
| Official Symbol | GIPR |
| Synonyms | GIPR; gastric inhibitory polypeptide receptor; GIP-R; glucose-dependent insulinotropic polypeptide receptor; PGQTL2; MGC126722; |
| Gene ID | 2696 |
| mRNA Refseq | NM_000164 |
| Protein Refseq | NP_000155 |
| UniProt ID | P48546 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GIPR Products
Required fields are marked with *
My Review for All GIPR Products
Required fields are marked with *



