Recombinant Human GIPR protein, His&Myc-tagged

Cat.No. : GIPR-2220H
Product Overview : Recombinant Human GIPR protein(P48546)(22-138aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His&Myc
Protein Length : 22-138aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 17.3 kDa
AA Sequence : RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name GIPR gastric inhibitory polypeptide receptor [ Homo sapiens ]
Official Symbol GIPR
Synonyms GIPR; gastric inhibitory polypeptide receptor; GIP-R; glucose-dependent insulinotropic polypeptide receptor; PGQTL2; MGC126722;
Gene ID 2696
mRNA Refseq NM_000164
Protein Refseq NP_000155
UniProt ID P48546

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GIPR Products

Required fields are marked with *

My Review for All GIPR Products

Required fields are marked with *

0
cart-icon
0
compare icon