Recombinant Human GIT1 Protein, His tagged

• Cat.No.: GIT1-001H
• Product Overview: Recombinant Human GIT1 Protein (485-636 aa) with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 485-636 aa
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose
• AA Sequence: MSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELEDDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYENTQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDHHHHHHHH
• Endotoxin: <1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Concentration: 1 mg/mL by BCA

Gene Information

• Official Symbol: GIT1
• Synonyms: GIT1; G protein-coupled receptor kinase interacting ArfGAP 1; G protein coupled receptor kinase interactor 1; ARF GTPase-activating protein GIT1; CAT1; CAT-1; ARF GAP GIT1; GRK-interacting protein 1; G protein-coupled receptor kinase interactor 1; G protein-coupled receptor kinase-interactor 1; cool-associated and tyrosine-phosphorylated protein 1
• Gene ID: 28964
• mRNA Refseq: NM_001085454
• Protein Refseq: NP_001078923
• MIM: 608434
• UniProt ID: Q9Y2X7