Recombinant Human GIT1 Protein, His tagged
| Cat.No. : | GIT1-001H |
| Product Overview : | Recombinant Human GIT1 Protein (485-636 aa) with His tag was expressed in E. coli. |
| Availability | December 02, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 485-636 aa |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose |
| AA Sequence : | MSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELEDDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYENTQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDHHHHHHHH |
| Endotoxin : | <1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Concentration : | 1 mg/mL by BCA |
| Official Symbol | GIT1 |
| Synonyms | GIT1; G protein-coupled receptor kinase interacting ArfGAP 1; G protein coupled receptor kinase interactor 1; ARF GTPase-activating protein GIT1; CAT1; CAT-1; ARF GAP GIT1; GRK-interacting protein 1; G protein-coupled receptor kinase interactor 1; G protein-coupled receptor kinase-interactor 1; cool-associated and tyrosine-phosphorylated protein 1; |
| Gene ID | 28964 |
| mRNA Refseq | NM_001085454 |
| Protein Refseq | NP_001078923 |
| MIM | 608434 |
| UniProt ID | Q9Y2X7 |
| ◆ Recombinant Proteins | ||
| GIT1-301196H | Recombinant Human GIT1 protein, GST-tagged | +Inquiry |
| GIT1-2200R | Recombinant Rat GIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GIT1-001H | Recombinant Human GIT1 Protein, His tagged | +Inquiry |
| GIT1-3983H | Recombinant Human GIT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GIT1-3568M | Recombinant Mouse GIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GIT1-5926HCL | Recombinant Human GIT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GIT1 Products
Required fields are marked with *
My Review for All GIT1 Products
Required fields are marked with *
