Recombinant Human GIT1 Protein, His tagged
Cat.No. : | GIT1-001H |
Product Overview : | Recombinant Human GIT1 Protein (485-636 aa) with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 485-636 aa |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose |
AA Sequence : | MSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELEDDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYENTQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDHHHHHHHH |
Endotoxin : | <1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Concentration : | 1 mg/mL by BCA |
Official Symbol | GIT1 |
Synonyms | GIT1; G protein-coupled receptor kinase interacting ArfGAP 1; G protein coupled receptor kinase interactor 1; ARF GTPase-activating protein GIT1; CAT1; CAT-1; ARF GAP GIT1; GRK-interacting protein 1; G protein-coupled receptor kinase interactor 1; G protein-coupled receptor kinase-interactor 1; cool-associated and tyrosine-phosphorylated protein 1; |
Gene ID | 28964 |
mRNA Refseq | NM_001085454 |
Protein Refseq | NP_001078923 |
MIM | 608434 |
UniProt ID | Q9Y2X7 |
◆ Recombinant Proteins | ||
GIT1-982H | Recombinant Human GIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GIT1-3983H | Recombinant Human GIT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GIT1-6366M | Recombinant Mouse GIT1 Protein | +Inquiry |
GIT1-301196H | Recombinant Human GIT1 protein, GST-tagged | +Inquiry |
GIT1-2814H | Recombinant Human GIT1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GIT1-001H | Recombinant Human GIT1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GIT1-5926HCL | Recombinant Human GIT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GIT1 Products
Required fields are marked with *
My Review for All GIT1 Products
Required fields are marked with *
0
Inquiry Basket