Recombinant Human GJA4 Protein, GST-tagged
Cat.No. : | GJA4-4922H |
Product Overview : | Human GJA4 full-length ORF ( NP_002051.2, 1 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction. [provided by RefSeq |
Molecular Mass : | 63.8 kDa |
AA Sequence : | MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GJA4 gap junction protein, alpha 4, 37kDa [ Homo sapiens ] |
Official Symbol | GJA4 |
Synonyms | GJA4; gap junction protein, alpha 4, 37kDa; gap junction protein, alpha 4, 37kD (connexin 37), gap junction protein, alpha 4, 37kDa (connexin 37); gap junction alpha-4 protein; connexin 37; CX37; connexin-37; |
Gene ID | 2701 |
mRNA Refseq | NM_002060 |
Protein Refseq | NP_002051 |
MIM | 121012 |
UniProt ID | P35212 |
◆ Recombinant Proteins | ||
GJA4-6996H | Recombinant Human GJA4 protein, His-tagged | +Inquiry |
RFL19593HF | Recombinant Full Length Human Gap Junction Alpha-4 Protein(Gja4) Protein, His-Tagged | +Inquiry |
GJA4-7107C | Recombinant Chicken GJA4 | +Inquiry |
GJA4-3571M | Recombinant Mouse GJA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL2986XF | Recombinant Full Length Xenopus Laevis Gap Junction Alpha-4 Protein(Gja4) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GJA4-5922HCL | Recombinant Human GJA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GJA4 Products
Required fields are marked with *
My Review for All GJA4 Products
Required fields are marked with *
0
Inquiry Basket