Recombinant Human GJA5 protein, His-tagged
Cat.No. : | GJA5-3787H |
Product Overview : | Recombinant Human GJA5 protein(233-341 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 233-341 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | KIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDK |
Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GJA5 gap junction protein, alpha 5, 40kDa [ Homo sapiens ] |
Official Symbol | GJA5 |
Synonyms | GJA5; gap junction protein, alpha 5, 40kDa; gap junction protein, alpha 5, 40kD (connexin 40) , gap junction protein, alpha 5, 40kDa (connexin 40); gap junction alpha-5 protein; connexin 40; CX40; connexin-40; ATFB11; MGC11185; |
Gene ID | 2702 |
mRNA Refseq | NM_005266 |
Protein Refseq | NP_005257 |
MIM | 121013 |
UniProt ID | P36382 |
◆ Cell & Tissue Lysates | ||
GJA5-5920HCL | Recombinant Human GJA5 293 Cell Lysate | +Inquiry |
GJA5-5921HCL | Recombinant Human GJA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GJA5 Products
Required fields are marked with *
My Review for All GJA5 Products
Required fields are marked with *
0
Inquiry Basket