Recombinant Human GLB1 protein, His-tagged
| Cat.No. : | GLB1-7758H |
| Product Overview : | Recombinant Human GLB1(Leu24-Val677) fused with His tag at C-terminal was expressed in HEK293. |
| Availability | December 01, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 24-677 a.a. |
| Description : | β Galactosidase is a lysosomal β Galactosidase that hydrolyzes the terminal β Galactose from Ganglioside and Keratan sulfate. In lysosome, the mature β Galactosidase protein associates with Cathepsin A and Neuraminidase 1 to form the lysosomal multienzyme complex . An alternative splicing at the RNA level of β Galactosidase results a catalytically inactive β Galactosidase that plays an important role in vascular development. Defects of β-galactosidase (GLB1) are the cause of diseases like GM1-gangliosidosis which is a lysosomal storage disease and Morquio Syndrome B that cause patients to have abnormal elastic fibers. More than 100 mutations have been identified for β Galactosidase, which result in different residual activities of the mutant enzymes and a spectrum of symptoms in the two related diseases. |
| Form : | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0. |
| AA Sequence : | LRNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNF HEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLLEKESILLRSSDPD YLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLF TTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQPHST IKTEAVASSLYDILARGASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYF ALRNIIQKFEKVPEGPIPPSTPKFAYGKVTLEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQHY GFVLYRTTLPQDCSNPAPLSSPLNGVHDRAYVAVDGIPQGVLERNNVITLNITGKAGATLDLLVE NMGRVNYGAYINDFKGLVSNLTLSSNILTDWTIFPLDTEDAVRSHLGGWGHRDSGHHDEAWAHNS SNYTLPAFYMGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLTLFVPQHIL MTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPPPPQKNKDSW LDHVVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| Storage : | Store at < -20 centigrade, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| Gene Name | GLB1 galactosidase, beta 1 [ Homo sapiens ] |
| Official Symbol | GLB1 |
| Synonyms | GLB1; galactosidase, beta 1; elastin receptor 1 (67kD) , elastin receptor 1, 67kDa , ELNR1; beta-galactosidase; EBP; lactase; acid beta-galactosidase; elastin receptor 1, 67kDa; ELNR1; MPS4B; |
| Gene ID | 2720 |
| mRNA Refseq | NM_000404 |
| Protein Refseq | NP_000395 |
| MIM | 611458 |
| UniProt ID | P16278 |
| Chromosome Location | 3p22.3 |
| Pathway | Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; Glycosaminoglycan degradation, organism-specific biosystem; Glycosaminoglycan degradation, conserved biosystem; Glycosphingolipid biosynthesis - ganglio series, organism-specific biosystem; Glycosphingolipid biosynthesis - ganglio series, conserved biosystem; Glycosphingolipid metabolism, organism-specific biosystem; |
| Function | beta-galactosidase activity; cation binding; galactoside binding; hydrolase activity, hydrolyzing O-glycosyl compounds; protein binding; |
| ◆ Recombinant Proteins | ||
| Gp9-183R | Recombinant Rat Gp9 Protein, His/GST-tagged | +Inquiry |
| Glb1-181M | Recombinant Mouse Glb1 Protein, His-tagged | +Inquiry |
| GLB1-6392M | Recombinant Mouse GLB1 Protein | +Inquiry |
| GLB1-417HFL | Recombinant Full Length Human GLB1 Protein, C-Flag-tagged | +Inquiry |
| Glb1-182R | Recombinant Rat Glb1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GLB1-5910HCL | Recombinant Human GLB1 293 Cell Lysate | +Inquiry |
| GLB1-5909HCL | Recombinant Human GLB1 293 Cell Lysate | +Inquiry |
| GLB1-175HKCL | Human GLB1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLB1 Products
Required fields are marked with *
My Review for All GLB1 Products
Required fields are marked with *
