"GLDC" Related Products

Expand

Recombinant Human GLDC Protein, GST-tagged

Cat.No.: GLDC-4950H
Product Overview: Human GLDC partial ORF ( NP_000161.1, 922 a.a. - 1020 a.a.) recombinant protein with GST-tag at N-terminal.
Description: The enzyme system for cleavage of glycine (glycine cleavage system; GCS; EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). Glycine encephalopathy (GCE; MIM 605899) may be due to a defect in any one of these enzymes; see MIM 238310, MIM 238330, and MIM 238331.[supplied by OMIM
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 36.63 kDa
AA Sequence: AMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFMKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASS
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: GLDC glycine dehydrogenase (decarboxylating) [ Homo sapiens ]
Official Symbol: GLDC
Synonyms: GLDC; glycine dehydrogenase (decarboxylating); glycine dehydrogenase (decarboxylating; glycine decarboxylase, glycine cleavage system protein P); glycine dehydrogenase [decarboxylating], mitochondrial; GCSP; glycine cleavage system protein P; glycine decarboxylase; NKH; glycine decarboxylase P-protein; glycine cleavage system P protein; GCE; HYGN1; MGC138198; MGC138200;
Gene ID: 2731
mRNA Refseq: NM_000170
Protein Refseq: NP_000161
MIM: 238300
UniProt ID: P23378

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.