Recombinant Human GLDC Protein, GST-tagged
Cat.No. : | GLDC-4950H |
Product Overview : | Human GLDC partial ORF ( NP_000161.1, 922 a.a. - 1020 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The enzyme system for cleavage of glycine (glycine cleavage system; GCS; EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). Glycine encephalopathy (GCE; MIM 605899) may be due to a defect in any one of these enzymes; see MIM 238310, MIM 238330, and MIM 238331.[supplied by OMIM |
Molecular Mass : | 36.63 kDa |
AA Sequence : | AMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFMKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GLDC glycine dehydrogenase (decarboxylating) [ Homo sapiens ] |
Official Symbol | GLDC |
Synonyms | GLDC; glycine dehydrogenase (decarboxylating); glycine dehydrogenase (decarboxylating; glycine decarboxylase, glycine cleavage system protein P); glycine dehydrogenase [decarboxylating], mitochondrial; GCSP; glycine cleavage system protein P; glycine decarboxylase; NKH; glycine decarboxylase P-protein; glycine cleavage system P protein; GCE; HYGN1; MGC138198; MGC138200; |
Gene ID | 2731 |
mRNA Refseq | NM_000170 |
Protein Refseq | NP_000161 |
MIM | 238300 |
UniProt ID | P23378 |
◆ Recombinant Proteins | ||
GLDC-3039H | Recombinant Human GLDC Protein, His (Fc)-Avi-tagged | +Inquiry |
GLDC-3591M | Recombinant Mouse GLDC Protein, His (Fc)-Avi-tagged | +Inquiry |
GLDC-4950H | Recombinant Human GLDC Protein, GST-tagged | +Inquiry |
GLDC-9957Z | Recombinant Zebrafish GLDC | +Inquiry |
GLDC-5895C | Recombinant Chicken GLDC | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLDC Products
Required fields are marked with *
My Review for All GLDC Products
Required fields are marked with *
0
Inquiry Basket