Recombinant Human GLI1 Protein (921-1106 aa), His-tagged

Cat.No. : GLI1-1254H
Product Overview : Recombinant Human GLI1 Protein (921-1106 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Developmental Biology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 921-1106 aa
Description : Acts as a transcriptional activator. May regulate the transcription of specific genes during normal development. May play a role in craniofacial development and digital development, as well as development of the central nervous syst and gastrointestinal tract. Mediates SHH signaling and thus cell proliferation and differentiation.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 23.3 kDa
AA Sequence : QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name GLI1 GLI family zinc finger 1 [ Homo sapiens ]
Official Symbol GLI1
Synonyms GLI1; oncogene GLI; GLI;
Gene ID 2735
mRNA Refseq NM_001160045
Protein Refseq NP_001153517
MIM 165220
UniProt ID P08151

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLI1 Products

Required fields are marked with *

My Review for All GLI1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon