Recombinant Human GLI1 Protein (921-1106 aa), His-tagged
| Cat.No. : | GLI1-1254H |
| Product Overview : | Recombinant Human GLI1 Protein (921-1106 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Developmental Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 921-1106 aa |
| Description : | Acts as a transcriptional activator. May regulate the transcription of specific genes during normal development. May play a role in craniofacial development and digital development, as well as development of the central nervous syst and gastrointestinal tract. Mediates SHH signaling and thus cell proliferation and differentiation. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 23.3 kDa |
| AA Sequence : | QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | GLI1 GLI family zinc finger 1 [ Homo sapiens ] |
| Official Symbol | GLI1 |
| Synonyms | GLI1; oncogene GLI; GLI; |
| Gene ID | 2735 |
| mRNA Refseq | NM_001160045 |
| Protein Refseq | NP_001153517 |
| MIM | 165220 |
| UniProt ID | P08151 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLI1 Products
Required fields are marked with *
My Review for All GLI1 Products
Required fields are marked with *



