Recombinant Human GLI1 Protein (921-1106 aa), His-tagged

• Cat.No.: GLI1-1254H
• Product Overview: Recombinant Human GLI1 Protein (921-1106 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Developmental Biology. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 921-1106 aa
• Description: Acts as a transcriptional activator. May regulate the transcription of specific genes during normal development. May play a role in craniofacial development and digital development, as well as development of the central nervous syst and gastrointestinal tract. Mediates SHH signaling and thus cell proliferation and differentiation.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 23.3 kDa
• AA Sequence: QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: GLI1 GLI family zinc finger 1 [ Homo sapiens ]
• Official Symbol: GLI1
• Synonyms: GLI1; oncogene GLI; GLI
• Gene ID: 2735
• mRNA Refseq: NM_001160045
• Protein Refseq: NP_001153517
• MIM: 165220
• UniProt ID: P08151