Recombinant Human GLI1 Protein (921-1106 aa), His-tagged
Cat.No. : | GLI1-1254H |
Product Overview : | Recombinant Human GLI1 Protein (921-1106 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Developmental Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 921-1106 aa |
Description : | Acts as a transcriptional activator. May regulate the transcription of specific genes during normal development. May play a role in craniofacial development and digital development, as well as development of the central nervous syst and gastrointestinal tract. Mediates SHH signaling and thus cell proliferation and differentiation. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 23.3 kDa |
AA Sequence : | QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | GLI1 GLI family zinc finger 1 [ Homo sapiens ] |
Official Symbol | GLI1 |
Synonyms | GLI1; oncogene GLI; GLI; |
Gene ID | 2735 |
mRNA Refseq | NM_001160045 |
Protein Refseq | NP_001153517 |
MIM | 165220 |
UniProt ID | P08151 |
◆ Recombinant Proteins | ||
GLI1-4955H | Recombinant Human GLI1 Protein, GST/pstS1-tagged | +Inquiry |
GLI1-598H | Recombinant Human GLI1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GLI1-312H | Recombinant Human GLI1 protein, MYC/DDK-tagged | +Inquiry |
GLI1-158H | Recombinant Human GLI1 protein, GST-tagged | +Inquiry |
GLI1-4954H | Recombinant Human GLI1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
GLI1-6401M | Recombinant Full Length Mouse GLI1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLI1-5905HCL | Recombinant Human GLI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLI1 Products
Required fields are marked with *
My Review for All GLI1 Products
Required fields are marked with *