Recombinant Human GLI1 protein, GST-tagged
Cat.No. : | GLI1-158H |
Product Overview : | Recombinant Human GLI1(800 - 849 aa) fused with GST tag at N-terminal was expressed in E. coli. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 800-849 a.a. |
Description : | This gene encodes a member of the Kruppel family of zinc finger proteins. The encoded transcription factor is activated by the sonic hedgehog signal transduction cascade and regulates stem cell proliferation. The activity and nuclear localization of this protein is negatively regulated by p53 in an inhibitory loop. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization. |
AA Sequence : | YSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEGPPHPQPLFS |
Purity : | > 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | GLI1 GLI family zinc finger 1 [ Homo sapiens ] |
Official Symbol | GLI1 |
Synonyms | GLI1; GLI family zinc finger 1; GLI, glioma associated oncogene family zinc finger 1 , glioma associated oncogene homolog 1 (zinc finger protein); zinc finger protein GLI1; oncogene GLI; glioma-associated oncogene 1; glioma-associated oncogene homolog 1 (zinc finger protein); GLI; |
Gene ID | 2735 |
mRNA Refseq | NM_001160045 |
Protein Refseq | NP_001153517 |
MIM | 165220 |
UniProt ID | P08151 |
Chromosome Location | 12q13.2-q13.3 |
Pathway | Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Hedgehog Signaling Pathway, organism-specific biosystem; Hedgehog signaling events mediated by Gli proteins, organism-specific biosystem; Hedgehog signaling pathway, organism-specific biosystem; Hedgehog signaling pathway, conserved biosystem; Pathways in cancer, organism-specific biosystem; |
Function | DNA binding; metal ion binding; protein binding; transcription regulatory region DNA binding; zinc ion binding; |
◆ Recombinant Proteins | ||
GLI1-3146H | Recombinant Human GLI1 protein, His-tagged | +Inquiry |
GLI1-3594M | Recombinant Mouse GLI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLI1-4954H | Recombinant Human GLI1 Protein, GST-tagged | +Inquiry |
Gli1-139R | Recombinant Rat Gli1 protein, His-tagged | +Inquiry |
GLI1-598H | Recombinant Human GLI1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
GLI1-6401M | Recombinant Full Length Mouse GLI1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLI1-5905HCL | Recombinant Human GLI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLI1 Products
Required fields are marked with *
My Review for All GLI1 Products
Required fields are marked with *
0
Inquiry Basket