Recombinant Human GLIPR1L1 Protein, GST-tagged
Cat.No. : | GLIPR1L1-4960H |
Product Overview : | Human GLIPR1L1 full-length ORF ( NP_689992.1, 1 a.a. - 233 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GLIPR1L1 (GLI Pathogenesis Related 1 Like 1) is a Protein Coding gene. An important paralog of this gene is GLIPR1. |
Molecular Mass : | 52.5 kDa |
AA Sequence : | MALKNKFSCLWILGLCLVATTSSKIPSITDPHFIDNCIEAHNEWRGKVNPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFLLLRIF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GLIPR1L1 GLI pathogenesis-related 1 like 1 [ Homo sapiens ] |
Official Symbol | GLIPR1L1 |
Synonyms | GLIPR1L1; GLI pathogenesis-related 1 like 1; GLIPR1-like protein 1; MGC26856; PRO7434; ALKN2972; |
Gene ID | 256710 |
mRNA Refseq | NM_152779 |
Protein Refseq | NP_689992 |
MIM | 610395 |
UniProt ID | Q6UWM5 |
◆ Recombinant Proteins | ||
GLIPR1L1-5330HF | Recombinant Full Length Human GLIPR1L1 Protein, GST-tagged | +Inquiry |
GLIPR1L1-3040H | Recombinant Human GLIPR1L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLIPR1L1-4960H | Recombinant Human GLIPR1L1 Protein, GST-tagged | +Inquiry |
GLIPR1L1-992H | Recombinant Human GLIPR1L1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLIPR1L1-711HCL | Recombinant Human GLIPR1L1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLIPR1L1 Products
Required fields are marked with *
My Review for All GLIPR1L1 Products
Required fields are marked with *
0
Inquiry Basket