Recombinant Human GLMN Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GLMN-5740H |
Product Overview : | GLMN MS Standard C13 and N15-labeled recombinant protein (NP_444504) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a phosphorylated protein that is a member of a Skp1-Cullin-F-box-like complex. The protein is essential for normal development of the vasculature and mutations in this gene have been associated with glomuvenous malformations, also called glomangiomas. Multiple splice variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 68.2 kDa |
AA Sequence : | MAVEELQSIIKRCQILEEQDFKEEDFGLFQLAGQRCIEEGHTDQLLEIIQNEKNKVIIKNMGWNLVGPVVRCLLCKDKEDSKRKVYFLIFDLLVKLCNPKELLLGLLELIEEPSGKQISQSILLLLQPLQTVIQKLHNKAYSIGLALSTLWNQLSLLPVPYSKEQIQMDDYGLCQCCKALIEFTKPFVEEVIDNKENSLENEKLKDELLKFCFKSLKCPLLTAQFFEQSEEGGNDPFRYFASEIIGFLSAIGHPFPKMIFNHGRKKRTWNYLEFEEEENKQLADSMASLAYLVFVQGIHIDQLPMVLSPLYLLQFNMGHIEVFLQRTEESVISKGLELLENSLLRIEDNSLLYQYLEIKSFLTVPQGLVKVMTLCPIETLRKKSLAMLQLYINKLDSQGKYTLFRCLLNTSNHSGVEAFIIQNIKNQIDMSLKRTRNNKWFTGPQLISLLDLVLFLPEGAETDLLQNSDRIMASLNLLRYLVIKDNENDNQTGLWTELGNIENNFLKPLHIGLNMSKAHYEAEIKNSQEAQKSKDLCSITVSGEEIPNMPPEMQLKVLHSALFTFDLIESVLARVEELIEIKTKSTSEENIGIKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GLMN glomulin, FKBP associated protein [ Homo sapiens (human) ] |
Official Symbol | GLMN |
Synonyms | GLMN; glomulin, FKBP associated protein; venous malformation with glomus cells, VMGLOM; glomulin; FAP48; FKBPAP; GLML; GVM; FKBP-associated protein; FK506-binding protein-associated protein; FAP; FAP68; VMGLOM; |
Gene ID | 11146 |
mRNA Refseq | NM_053274 |
Protein Refseq | NP_444504 |
MIM | 601749 |
UniProt ID | Q92990 |
◆ Recombinant Proteins | ||
GLMN-5740H | Recombinant Human GLMN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GLMN-6411M | Recombinant Mouse GLMN Protein | +Inquiry |
GLMN-4965H | Recombinant Human GLMN Protein, GST-tagged | +Inquiry |
GLMN-3598M | Recombinant Mouse GLMN Protein, His (Fc)-Avi-tagged | +Inquiry |
GLMN-5335HF | Recombinant Full Length Human GLMN Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLMN-5900HCL | Recombinant Human GLMN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLMN Products
Required fields are marked with *
My Review for All GLMN Products
Required fields are marked with *
0
Inquiry Basket