Recombinant Human GLOD4, His-tagged
| Cat.No. : | GLOD4-27652TH |
| Product Overview : | Recombinant full length Human GLOD4 with N terminal His tag; 318 amino acids with tag, Predicted MWt 35.3. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 298 amino acids |
| Description : | GLOD4, also known glyoxalase domain-containing protein 4, is an enzyme that belongs to the glyoxalase system. |
| Conjugation : | HIS |
| Molecular Weight : | 35.300kDa inclusive of tags |
| Tissue specificity : | Expressed in heart, brain, liver, kidney, pancreas and placenta. Not expressed in skeletal muscle and lung. |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAARRALHFVFKVGNRFQTARFYRDVLGMKVLRHEEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGVGDYKLGNDFMGITLASSQAVSNARKLEWPLTEVAEGVFETEAPGGYKFYLQNRSLPQSDPVLKVTLAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGSKLLDDAMAADKSDEWFAKHNKPKASG |
| Sequence Similarities : | Belongs to the glyoxalase I family. |
| Gene Name | GLOD4 glyoxalase domain containing 4 [ Homo sapiens ] |
| Official Symbol | GLOD4 |
| Synonyms | GLOD4; glyoxalase domain containing 4; C17orf25, chromosome 17 open reading frame 25; glyoxalase domain-containing protein 4; CGI 150; HC71; |
| Gene ID | 51031 |
| mRNA Refseq | NM_016080 |
| Protein Refseq | NP_057164 |
| Uniprot ID | Q9HC38 |
| Chromosome Location | 17p13.3 |
| ◆ Recombinant Proteins | ||
| GLOD4-6932H | Recombinant Human GLOD4 protein, His-tagged | +Inquiry |
| GLOD4-3599M | Recombinant Mouse GLOD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GLOD4-6412M | Recombinant Mouse GLOD4 Protein | +Inquiry |
| GLOD4-4968H | Recombinant Human GLOD4 Protein, GST-tagged | +Inquiry |
| GLOD4-2220R | Recombinant Rat GLOD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GLOD4-212HCL | Recombinant Human GLOD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLOD4 Products
Required fields are marked with *
My Review for All GLOD4 Products
Required fields are marked with *
