Recombinant Human GLOD4, His-tagged

Cat.No. : GLOD4-27652TH
Product Overview : Recombinant full length Human GLOD4 with N terminal His tag; 318 amino acids with tag, Predicted MWt 35.3.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 298 amino acids
Description : GLOD4, also known glyoxalase domain-containing protein 4, is an enzyme that belongs to the glyoxalase system.
Conjugation : HIS
Molecular Weight : 35.300kDa inclusive of tags
Tissue specificity : Expressed in heart, brain, liver, kidney, pancreas and placenta. Not expressed in skeletal muscle and lung.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMAARRALHFVFKVGNRFQTARFYRDVLGMKVLRHEEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGVGDYKLGNDFMGITLASSQAVSNARKLEWPLTEVAEGVFETEAPGGYKFYLQNRSLPQSDPVLKVTLAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGSKLLDDAMAADKSDEWFAKHNKPKASG
Sequence Similarities : Belongs to the glyoxalase I family.
Gene Name GLOD4 glyoxalase domain containing 4 [ Homo sapiens ]
Official Symbol GLOD4
Synonyms GLOD4; glyoxalase domain containing 4; C17orf25, chromosome 17 open reading frame 25; glyoxalase domain-containing protein 4; CGI 150; HC71;
Gene ID 51031
mRNA Refseq NM_016080
Protein Refseq NP_057164
Uniprot ID Q9HC38
Chromosome Location 17p13.3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLOD4 Products

Required fields are marked with *

My Review for All GLOD4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon