Recombinant Human GLOD4, His-tagged

• Cat.No.: GLOD4-27652TH
• Product Overview: Recombinant full length Human GLOD4 with N terminal His tag; 318 amino acids with tag, Predicted MWt 35.3.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 298 amino acids
• Description: GLOD4, also known glyoxalase domain-containing protein 4, is an enzyme that belongs to the glyoxalase system.
• Conjugation: HIS
• Molecular Weight: 35.300kDa inclusive of tags
• Tissue specificity: Expressed in heart, brain, liver, kidney, pancreas and placenta. Not expressed in skeletal muscle and lung.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAARRALHFVFKVGNRFQTARFYRDVLGMKVLRHEEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGVGDYKLGNDFMGITLASSQAVSNARKLEWPLTEVAEGVFETEAPGGYKFYLQNRSLPQSDPVLKVTLAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGSKLLDDAMAADKSDEWFAKHNKPKASG
• Sequence Similarities: Belongs to the glyoxalase I family.

Gene Information

• Gene Name: GLOD4 glyoxalase domain containing 4 [ Homo sapiens ]
• Official Symbol: GLOD4
• Synonyms: GLOD4; glyoxalase domain containing 4; C17orf25, chromosome 17 open reading frame 25; glyoxalase domain-containing protein 4; CGI 150; HC71
• Gene ID: 51031
• mRNA Refseq: NM_016080
• Protein Refseq: NP_057164
• Uniprot ID: Q9HC38
• Chromosome Location: 17p13.3