Recombinant Human GLOD4 Protein, GST-tagged

Cat.No. : GLOD4-4968H
Product Overview : Human GLOD4 full-length ORF ( AAH15848.1, 1 a.a. - 298 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GLOD4 (Glyoxalase Domain Containing 4) is a Protein Coding gene. Diseases associated with GLOD4 include Hepatocellular Carcinoma.
Molecular Mass : 59.6 kDa
AA Sequence : MAARRALHFVFKVGNRFQTARFYRDVLGMKVLRHEEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGVGDYKLGNDFMGITLASSQAVSNARKLEWPLTEVAEGVFETEAPGGYKFYLQNRSLPQSDPVLKVTLAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKIDPEGSKLLDDAMAADKSDEWFAKHNKPKASG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GLOD4 glyoxalase domain containing 4 [ Homo sapiens ]
Official Symbol GLOD4
Synonyms GLOD4; glyoxalase domain containing 4; C17orf25, chromosome 17 open reading frame 25; glyoxalase domain-containing protein 4; CGI 150; HC71; CGI-150; C17orf25;
Gene ID 51031
mRNA Refseq NM_016080
Protein Refseq NP_057164
UniProt ID Q9HC38

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLOD4 Products

Required fields are marked with *

My Review for All GLOD4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon