Recombinant Human GLP1R Protein, His-tagged
| Cat.No. : | GLP1R-1228H |
| Product Overview : | Recombinant Human GLP1R Protein (24-145aa) was expressed in E. coli with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 24-145 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 18.3 kDa |
| AA Sequence : | RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWAS SVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | GLP1R glucagon-like peptide 1 receptor [ Homo sapiens ] |
| Official Symbol | GLP1R |
| Synonyms | GLP1R; glucagon-like peptide 1 receptor; GLP-1R; GLP-1-R; GLP-1 receptor; MGC138331 |
| Gene ID | 2740 |
| mRNA Refseq | NM_002062 |
| Protein Refseq | NP_002053 |
| MIM | 138032 |
| UniProt ID | P43220 |
| ◆ Native Proteins | ||
| GLP1R-549C | Recombinant Cynomolgus GLP1R Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLP1R Products
Required fields are marked with *
My Review for All GLP1R Products
Required fields are marked with *
