Recombinant Human GLP1R Protein, His-tagged

• Cat.No.: GLP1R-1228H
• Product Overview: Recombinant Human GLP1R Protein (24-145aa) was expressed in E. coli with N-terminal His tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 24-145 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 18.3 kDa
• AA Sequence: RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWAS
  SVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: GLP1R glucagon-like peptide 1 receptor [ Homo sapiens ]
• Official Symbol: GLP1R
• Synonyms: GLP1R; glucagon-like peptide 1 receptor; GLP-1R; GLP-1-R; GLP-1 receptor; MGC138331
• Gene ID: 2740
• mRNA Refseq: NM_002062
• Protein Refseq: NP_002053
• MIM: 138032
• UniProt ID: P43220