Recombinant Human GLP1R Protein, His-tagged
Cat.No. : | GLP1R-1228H |
Product Overview : | Recombinant Human GLP1R Protein (24-145aa) was expressed in E. coli with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-145 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 18.3 kDa |
AA Sequence : | RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWAS SVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | GLP1R glucagon-like peptide 1 receptor [ Homo sapiens ] |
Official Symbol | GLP1R |
Synonyms | GLP1R; glucagon-like peptide 1 receptor; GLP-1R; GLP-1-R; GLP-1 receptor; MGC138331 |
Gene ID | 2740 |
mRNA Refseq | NM_002062 |
Protein Refseq | NP_002053 |
MIM | 138032 |
UniProt ID | P43220 |
◆ Recombinant Proteins | ||
RFL22237HF | Recombinant Full Length Human Glucagon-Like Peptide 1 Receptor(Glp1R) Protein, His-Tagged | +Inquiry |
GLP1R-1932H | Active Recombinant Human GLP1R Full Length Transmembrane protein(Nanodisc) | +Inquiry |
GLP1R-01D | Recombinant Dog GLP1R Protein, His-tagged | +Inquiry |
GLP1R-1228H | Recombinant Human GLP1R Protein, His-tagged | +Inquiry |
Glp1r-2223R | Recombinant Rat Glp1r protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLP1R Products
Required fields are marked with *
My Review for All GLP1R Products
Required fields are marked with *
0
Inquiry Basket