Recombinant Human GLRA3 protein, His-tagged
| Cat.No. : | GLRA3-3003H |
| Product Overview : | Recombinant Human GLRA3 protein(29-255 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 30, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 29-255 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | KETDSARSRSAPMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTKHYNTGKFTCIEVRFHLERQMGY |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | GLRA3 glycine receptor, alpha 3 [ Homo sapiens ] |
| Official Symbol | GLRA3 |
| Synonyms | GLRA3; glycine receptor, alpha 3; glycine receptor subunit alpha-3; ligand gated ion channel; glycine receptor alpha 3 subunit; glycine receptor, alpha-3 polypeptide; |
| Gene ID | 8001 |
| mRNA Refseq | NM_001042543 |
| Protein Refseq | NP_001036008 |
| MIM | 600421 |
| UniProt ID | O75311 |
| ◆ Recombinant Proteins | ||
| GLRA3-9431Z | Recombinant Zebrafish GLRA3 | +Inquiry |
| GLRA3-3003H | Recombinant Human GLRA3 protein, His-tagged | +Inquiry |
| GLRA3-13309H | Recombinant Human GLRA3, GST-tagged | +Inquiry |
| GLRA3-4974H | Recombinant Human GLRA3 Protein, GST-tagged | +Inquiry |
| GLRA3-5345HF | Recombinant Full Length Human GLRA3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLRA3 Products
Required fields are marked with *
My Review for All GLRA3 Products
Required fields are marked with *
