Recombinant Human GLRX Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GLRX-5205H |
Product Overview : | GLRX MS Standard C13 and N15-labeled recombinant protein (NP_001112362) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the glutaredoxin family. The encoded protein is a cytoplasmic enzyme catalyzing the reversible reduction of glutathione-protein mixed disulfides. This enzyme highly contributes to the antioxidant defense system. It is crucial for several signalling pathways by controlling the S-glutathionylation status of signalling mediators. It is involved in beta-amyloid toxicity and Alzheimer's disease. Multiple alternatively spliced transcript variants encoding the same protein have been identified. |
Molecular Mass : | 11.8 kDa |
AA Sequence : | MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GLRX glutaredoxin [ Homo sapiens (human) ] |
Official Symbol | GLRX |
Synonyms | GLRX; glutaredoxin (thioltransferase); glutaredoxin-1; GRX; GRX1; TTase-1; thioltransferase-1; FLJ43648; MGC117407; |
Gene ID | 2745 |
mRNA Refseq | NM_001118890 |
Protein Refseq | NP_001112362 |
MIM | 600443 |
UniProt ID | P35754 |
◆ Recombinant Proteins | ||
Glrx-631M | Recombinant Mouse Glrx Protein, His-tagged | +Inquiry |
GLRX-1476Z | Recombinant Zebrafish GLRX | +Inquiry |
GLRX-138H | Recombinant Human Glutaredoxin-1 | +Inquiry |
GLRX-78H | Recombinant Human GLRX | +Inquiry |
GLRX-014H | Recombinant Human GLRX Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLRX-5898HCL | Recombinant Human GLRX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLRX Products
Required fields are marked with *
My Review for All GLRX Products
Required fields are marked with *