Recombinant Human GLRX Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GLRX-5205H
• Product Overview: GLRX MS Standard C13 and N15-labeled recombinant protein (NP_001112362) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the glutaredoxin family. The encoded protein is a cytoplasmic enzyme catalyzing the reversible reduction of glutathione-protein mixed disulfides. This enzyme highly contributes to the antioxidant defense system. It is crucial for several signalling pathways by controlling the S-glutathionylation status of signalling mediators. It is involved in beta-amyloid toxicity and Alzheimer's disease. Multiple alternatively spliced transcript variants encoding the same protein have been identified.
• Molecular Mass: 11.8 kDa
• AA Sequence: MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GLRX glutaredoxin [ Homo sapiens (human) ]
• Official Symbol: GLRX
• Synonyms: GLRX; glutaredoxin (thioltransferase); glutaredoxin-1; GRX; GRX1; TTase-1; thioltransferase-1; FLJ43648; MGC117407
• Gene ID: 2745
• mRNA Refseq: NM_001118890
• Protein Refseq: NP_001112362
• MIM: 600443
• UniProt ID: P35754