| Cat.No. : | GLRX3-4977H |
| Product Overview : | Human GLRX3 full-length ORF ( AAH05289, 1 a.a. - 335 a.a.) recombinant protein with GST-tag at N-terminal. |
| Description : | This gene encodes a member of the glutaredoxin family. Glutaredoxins are oxidoreductase enzymes that reduce a variety of substrates using glutathione as a cofactor. The encoded protein binds to and modulates the function of protein kinase C theta. The encoded protein may also inhibit apoptosis and play a role in cellular growth, and the expression of this gene may be a marker for cancer. Pseudogenes of this gene are located on the short arm of chromosomes 6 and 9. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2010] |
| Source : | Wheat Germ |
| Species : | Human |
| Tag : | GST |
| Molecular Mass : | 62.59 kDa |
| AA Sequence : | MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Quality Control Testing : |
12.5% SDS-PAGE Stained with Coomassie Blue. |
| Gene Name : | GLRX3 glutaredoxin 3 [ Homo sapiens ] |
| Official Symbol : | GLRX3 |
| Synonyms : | GLRX3; glutaredoxin 3; thioredoxin like 2, TXNL2; glutaredoxin-3; bA500G10.4; GLRX4; glutaredoxin 4; GRX3; GRX4; PICOT; PKCq-interacting protein; thioredoxin-like protein 2; PKC-theta-interacting protein; PKC-interacting cousin of thioredoxin; TXNL2; TXNL3; FLJ11864; |
| Gene ID : | 10539 |
| mRNA Refseq : | NM_001199868 |
| Protein Refseq : | NP_001186797 |
| MIM : | 612754 |
| UniProt ID : | O76003 |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All GLRX3 Products
Download Datasheet