Recombinant Human GLRX3 Protein, GST-tagged
Cat.No. : | GLRX3-4977H |
Product Overview : | Human GLRX3 full-length ORF ( AAH05289, 1 a.a. - 335 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the glutaredoxin family. Glutaredoxins are oxidoreductase enzymes that reduce a variety of substrates using glutathione as a cofactor. The encoded protein binds to and modulates the function of protein kinase C theta. The encoded protein may also inhibit apoptosis and play a role in cellular growth, and the expression of this gene may be a marker for cancer. Pseudogenes of this gene are located on the short arm of chromosomes 6 and 9. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2010] |
Molecular Mass : | 62.59 kDa |
AA Sequence : | MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GLRX3 glutaredoxin 3 [ Homo sapiens ] |
Official Symbol | GLRX3 |
Synonyms | GLRX3; glutaredoxin 3; thioredoxin like 2, TXNL2; glutaredoxin-3; bA500G10.4; GLRX4; glutaredoxin 4; GRX3; GRX4; PICOT; PKCq-interacting protein; thioredoxin-like protein 2; PKC-theta-interacting protein; PKC-interacting cousin of thioredoxin; TXNL2; TXNL3; FLJ11864; |
Gene ID | 10539 |
mRNA Refseq | NM_001199868 |
Protein Refseq | NP_001186797 |
MIM | 612754 |
UniProt ID | O76003 |
◆ Recombinant Proteins | ||
GLRX3-5073H | Recombinant Human GLRX3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GLRX3-2227R | Recombinant Rat GLRX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLRX3-3603M | Recombinant Mouse GLRX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Glrx3-629M | Recombinant Mouse Glrx3 Protein, His-tagged | +Inquiry |
GLRX3-989H | Recombinant Human GLRX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLRX3-5897HCL | Recombinant Human GLRX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLRX3 Products
Required fields are marked with *
My Review for All GLRX3 Products
Required fields are marked with *