Recombinant Human GLRX3 protein, GST-tagged
| Cat.No. : | GLRX3-2969H |
| Product Overview : | Recombinant Human GLRX3 protein(O76003)(1-335aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-335aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 64.3 kDa |
| AA Sequence : | AAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | GLRX3 glutaredoxin 3 [ Homo sapiens ] |
| Official Symbol | GLRX3 |
| Synonyms | GLRX3; glutaredoxin 3; thioredoxin like 2 , TXNL2; glutaredoxin-3; bA500G10.4; GLRX4; glutaredoxin 4; GRX3; GRX4; PICOT; PKCq-interacting protein; thioredoxin-like protein 2; PKC-theta-interacting protein; PKC-interacting cousin of thioredoxin; TXNL2; TXNL3; FLJ11864; |
| Gene ID | 10539 |
| mRNA Refseq | NM_001199868 |
| Protein Refseq | NP_001186797 |
| MIM | 612754 |
| UniProt ID | O76003 |
| ◆ Recombinant Proteins | ||
| GLRX3-2902H | Recombinant Human GLRX3 Protein (Val10-Ser117), His tagged | +Inquiry |
| GLRX3-627H | Recombinant Human GLRX3 Protein, His-tagged | +Inquiry |
| GLRX3-13313H | Recombinant Human GLRX3, GST-tagged | +Inquiry |
| GLRX3-1480Z | Recombinant Zebrafish GLRX3 | +Inquiry |
| GLRX3-4797C | Recombinant Chicken GLRX3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GLRX3-5897HCL | Recombinant Human GLRX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLRX3 Products
Required fields are marked with *
My Review for All GLRX3 Products
Required fields are marked with *
