Recombinant Human GLRX3 protein, GST-tagged
Cat.No. : | GLRX3-2969H |
Product Overview : | Recombinant Human GLRX3 protein(O76003)(1-335aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-335aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 64.3 kDa |
AA Sequence : | AAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GLRX3 glutaredoxin 3 [ Homo sapiens ] |
Official Symbol | GLRX3 |
Synonyms | GLRX3; glutaredoxin 3; thioredoxin like 2 , TXNL2; glutaredoxin-3; bA500G10.4; GLRX4; glutaredoxin 4; GRX3; GRX4; PICOT; PKCq-interacting protein; thioredoxin-like protein 2; PKC-theta-interacting protein; PKC-interacting cousin of thioredoxin; TXNL2; TXNL3; FLJ11864; |
Gene ID | 10539 |
mRNA Refseq | NM_001199868 |
Protein Refseq | NP_001186797 |
MIM | 612754 |
UniProt ID | O76003 |
◆ Recombinant Proteins | ||
GLRX3-5073H | Recombinant Human GLRX3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GLRX3-4797C | Recombinant Chicken GLRX3 | +Inquiry |
GLRX3-3603M | Recombinant Mouse GLRX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLRX3-989H | Recombinant Human GLRX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLRX3-31637TH | Recombinant Human GLRX3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLRX3-5897HCL | Recombinant Human GLRX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLRX3 Products
Required fields are marked with *
My Review for All GLRX3 Products
Required fields are marked with *
0
Inquiry Basket