Recombinant Human GM2A

• Cat.No.: GM2A-27456TH
• Product Overview: Recombinant fragment of Human GM2A with N terminal proprietary tag; Predicted MW 36.63 kDa

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. Alternative splicing results in multiple transcript variants.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: WIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI

Gene Information

• Gene Name: GM2A GM2 ganglioside activator [ Homo sapiens ]
• Official Symbol: GM2A
• Synonyms: GM2A; GM2 ganglioside activator; GM2 ganglioside activator protein; ganglioside GM2 activator; cerebroside sulfate activator protein; SAP 3; sphingolipid activator protein 3
• Gene ID: 2760
• mRNA Refseq: NM_000405
• Protein Refseq: NP_000396
• MIM: 613109
• Uniprot ID: P17900
• Chromosome Location: 5q33.1
• Pathway: Lysosome, organism-specific biosystem; Lysosome, conserved biosystem
• Function: beta-N-acetylhexosaminidase activity; sphingolipid activator protein activity