Recombinant Human GM2A
| Cat.No. : | GM2A-27456TH |
| Product Overview : | Recombinant fragment of Human GM2A with N terminal proprietary tag; Predicted MW 36.63 kDa |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. Alternative splicing results in multiple transcript variants. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | WIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI |
| Gene Name | GM2A GM2 ganglioside activator [ Homo sapiens ] |
| Official Symbol | GM2A |
| Synonyms | GM2A; GM2 ganglioside activator; GM2 ganglioside activator protein; ganglioside GM2 activator; cerebroside sulfate activator protein; SAP 3; sphingolipid activator protein 3; |
| Gene ID | 2760 |
| mRNA Refseq | NM_000405 |
| Protein Refseq | NP_000396 |
| MIM | 613109 |
| Uniprot ID | P17900 |
| Chromosome Location | 5q33.1 |
| Pathway | Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; |
| Function | beta-N-acetylhexosaminidase activity; sphingolipid activator protein activity; |
| ◆ Recombinant Proteins | ||
| GM2A-27456TH | Recombinant Human GM2A | +Inquiry |
| GM2A-128H | Recombinant Human GM2A Protein (Met1-Ile193), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| GM2A-993H | Recombinant Human GM2A Protein, His (Fc)-Avi-tagged | +Inquiry |
| GM2A-3471H | Recombinant Human GM2A protein, His-tagged | +Inquiry |
| GM2A-5001H | Recombinant Human GM2A Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GM2A-450HCL | Recombinant Human GM2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GM2A Products
Required fields are marked with *
My Review for All GM2A Products
Required fields are marked with *
